(data stored in ACNUC7421 zone)

EMBL: CP000821.PE488

CP000821.PE488       Location/Qualifiers
FT   CDS_pept        601920..602420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0488"
FT                   /product="NosL family protein"
FT                   /note="KEGG: she:Shewmr4_0494 NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35101"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH8"
FT                   /protein_id="ABV35101.1"
FT                   /translation="MKKIICLLFLLPLLLACTQGAEDVPQAKAEAIEKHERCHLCGMMI
FT                   TKYPGPKGQVHLKGQSVVPKFCSTRDMFNFSLQAENKRQISALFVHDMGATDWEQPGDD
FT                   AFIDAFIDAKTAWYVYGTSKKAVMGPAVASFKRQSQAVKFAQEFGGAVLPFEQVDLALL
FT                   SGE"
     atgaaaaaga taatctgttt attgttcctg cttcctctgc ttctggcttg tactcaaggc        60
     gctgaagatg ttccacaagc taaagccgag gcaattgaaa agcatgagcg atgtcaccta       120
     tgcgggatga tgatcactaa atacccgggt ccaaaggggc aggttcatct gaaagggcaa       180
     tcggttgtgc ctaagttctg ctctacccgg gatatgttta atttctcact gcaggccgaa       240
     aacaaacggc aaatctcagc gttgtttgtc catgatatgg gggcgacgga ttgggagcag       300
     cctggtgatg atgcctttat cgatgccttt atcgatgcca aaacggcctg gtatgtatac       360
     ggtaccagca aaaaagcagt catgggacca gcagtagcca gctttaagcg tcagtctcag       420
     gcggtgaagt ttgcccagga gtttggcggt gccgttctgc cgtttgagca ggtcgatctt       480
     gccctgttat ccggcgaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page