(data stored in ACNUC7421 zone)

EMBL: CP000821.PE490

CP000821.PE490       Location/Qualifiers
FT   CDS_pept        603793..604701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0490"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35103"
FT                   /db_xref="GOA:A8FQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI0"
FT                   /protein_id="ABV35103.1"
FT                   /translation="MLSEVPIKLTDIVLKYDDFTALDGVSFEVEAGQTMALLGHNGAGK
FT                   SSIIKVILGLIAPSSGSVKIMGKSAQSSHLQHKVNLGYLPEDVSFYDKLTGREVLNYFA
FT                   ALKRVRPTRVADLIDEFGLGYAQDRQLKTYSKGMKQRLGVAQAILSEPGILLLDEPTVG
FT                   LDPQASQFLYGKINQLKNSGCAVVVSTHELPLVESHMDSALIMSKGRRLAQGTSSELSA
FT                   GSSLKAKIDFGELTSLVERDHYLRRFFIDGRLQVESGQKQHMIKYLVSQCQIFDFTIDE
FT                   PKLEDIYHDLMVHPLLDQPAQ"
     atgttgagtg aagttccgat aaagctgacc gatattgtcc tcaaatatga tgatttcaca        60
     gctctggacg gtgtcagttt tgaggtggaa gcagggcaga ctatggccct acttggtcat       120
     aacggtgcag ggaaatccag tataatcaaa gttatactcg ggttgatcgc tcccagttca       180
     ggttctgtaa aaattatggg aaagagcgcc caatcatctc atctccagca taaagtcaat       240
     cttggctatc tgccagaaga tgtgagtttt tacgacaagc taaccggtag ggaggtgctg       300
     aattactttg ctgcccttaa gcgggttcgt ccaacgcgtg tcgccgatct tatcgatgag       360
     tttgggcttg gttatgctca ggacagacag cttaagacct actcgaaagg gatgaagcag       420
     cgcttagggg tggcacaggc catactgtca gagcctggaa ttctactgct cgatgagccc       480
     actgtcgggc tcgatcctca agcttctcaa tttctctatg gaaagattaa tcagttgaaa       540
     aacagtgggt gcgccgtggt agtgagcact cacgaactgc cccttgtcga gtctcatatg       600
     gatagcgcct tgataatgtc gaaggggaga cgactcgcac agggaacgag ttctgagttg       660
     agtgccggaa gttcgttaaa ggccaagatt gattttggcg aactgacttc gttggttgag       720
     cgtgaccact acttgaggcg gttttttatc gacggccgat tacaggtcga gtcgggtcaa       780
     aagcaacaca tgattaaata cttagtatca caatgtcaga tcttcgactt caccatagat       840
     gaaccaaagc tggaagatat ttaccatgac ttgatggtgc atcccctttt ggaccagcct       900
     gcgcagtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page