(data stored in ACNUC7421 zone)

EMBL: CP000821.PE491

CP000821.PE491       Location/Qualifiers
FT   CDS_pept        604714..605553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0491"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35104"
FT                   /db_xref="GOA:A8FQI1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI1"
FT                   /protein_id="ABV35104.1"
FT                   /translation="MNRFTSPVLIIASKEICDSSRNRWLAFMGSIFLLLSLSVTFAGSA
FT                   VTGSLYLPELASLMSSLSTISVFIIPLAAILLSYDSFVGEDESGTLLLLLSYPLTRLQI
FT                   LCGKLLGHMTVMLLATSFAFGVTAILLLLIGEQYQVAELIGAFAQFLLSSNLLALTFIL
FT                   FSYIVSLKSTEKAKAVGTLLLVWFLFVLIYDLLLLTILVSDLSFANQYVVNILIALSPT
FT                   DLYRAINLMAIEGGDGRGSLAMLTETDWGLPGMYVLMLLWIALLSWISHGIFKRKRL"
     atgaacagat ttacatcccc cgtattgatt atcgccagta aagagatctg tgatagttcc        60
     cgaaatcgtt ggttagcttt catgggtagc atcttcctgt tgctctcctt gagtgtaacc       120
     tttgccggca gtgccgttac cggaagtctc taccttccgg agcttgccag cctgatgagt       180
     agcctgtcga ctatatcggt atttatcatc cctttagcgg cgatcttact cagttatgat       240
     agtttcgtcg gtgaagatga gtctggtacc ttgctcctgc tgctctccta ccctctgacc       300
     cgattacaga tcctctgtgg aaaattactc ggacatatga ctgtcatgct attggcaacc       360
     agttttgcgt ttggagttac tgcaatattg ctgctgttaa ttggcgagca atatcaagtt       420
     gccgagttaa tcggtgcatt tgctcagttt ctgctaagta gcaacttatt ggccttgacc       480
     tttattttat tcagctacat cgtcagcctt aaaagcactg agaaggccaa ggcggtgggc       540
     accctgctgc tggtgtggtt tctgtttgta cttatctatg atctgttact actgactatt       600
     ttggtttcag atctctcctt tgcgaatcaa tatgttgtaa atatcttaat tgcattgagt       660
     ccgaccgatc tctatcgggc cataaacctg atggctatcg aggggggcga tgggagagga       720
     agtcttgcaa tgctcacaga gaccgactgg ggactgcctg ggatgtatgt cctgatgttg       780
     ttatggatag cgctgttaag ttggatctcc catggaattt ttaagcgtaa acgcctctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page