(data stored in ACNUC7421 zone)

EMBL: CP000821.PE494

CP000821.PE494       Location/Qualifiers
FT   CDS_pept        609839..610267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35107"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI4"
FT                   /protein_id="ABV35107.1"
FT                   /translation="MKKALGQIVVSLTLLLSAATCFAGGGSDMAPAPHQDVQLNPISMT
FT                   EAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVKDWKKLLPENKDTVMVFYCANRLC
FT                   NASEIAARAVMKLGYTGVRHMYDGIYGWRLANRVTEKP"
     atgaagaaag cactgggtca aattgttgtt tcactcactt tactgttaag cgctgcaact        60
     tgttttgccg gaggcggttc ggatatggca ccggctcccc accaagacgt tcagttaaac       120
     ccgatctcaa tgacagaggc cgaaacattg gtgggtaaag agggtgtcta cttttttgat       180
     gttaatacgc ttgagctttg ggctgaaggg tatattccag gtgctatcta tttcaacgtt       240
     aaagattgga aaaaactact tccagagaat aaagataccg tgatggtttt ttactgcgcc       300
     aaccgtctgt gtaacgccag tgaaatcgcg gcaagagccg taatgaagct tgggtatacc       360
     ggagtacgac acatgtatga cgggatatat gggtggcgtt tagcaaaccg agtgacggaa       420
     aaaccataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page