(data stored in ACNUC7421 zone)

EMBL: CP000821.PE496

CP000821.PE496       Location/Qualifiers
FT   CDS_pept        611182..611904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0496"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0351 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI6"
FT                   /protein_id="ABV35109.1"
FT                   /translation="MNSLAIGIGVTLCAFIALIWRHHLRCLNQGVIHIAKQSNACDSEV
FT                   ITPSLDIKIPVLLSIVLLFSSVSLYSQLGHFSDWDKGSVDEHIDYLITADINKNAKTVN
FT                   EQPNNEIALLNLAQSYADGGLYSDSVKTFDELLQLTGDDAGILGMKANAMYYRDNRAMS
FT                   LDIDLVIARALAIDEYEFQSRLLLATHGYLNGNYEEAIKQWELLLKSDSQSFNRDSINN
FT                   AILRAEQKIANRSVTASE"
     atgaatagtc ttgctatcgg tattggggta acactttgtg cttttatagc actgatctgg        60
     cgacatcatc tccggtgtct caatcaaggg gtcattcata ttgcaaagca gtcaaatgca       120
     tgtgatagcg aagtgataac accatcttta gatataaaga tacctgtgct gctatccata       180
     gtgctccttt tttcgagcgt atcactttac tcgcaactgg gtcacttcag tgactgggat       240
     aaagggagcg tagatgaaca tattgattac ctgatcaccg cagatatcaa taaaaatgca       300
     aaaacagtta atgagcaacc aaacaatgaa attgcattat taaatttggc tcaatcttat       360
     gccgatggtg ggctttattc agattcagtg aaaaccttcg atgaactact tcagttaacg       420
     ggtgatgatg ccggtatttt gggcatgaaa gccaatgcca tgtactaccg tgataaccgg       480
     gcgatgagtc tcgatatcga tctcgttatc gccagagcac tcgctatcga tgaatatgaa       540
     tttcagtcca gattactgct agcgactcac ggatacctta atggaaatta tgaagaagcc       600
     attaagcagt gggagttgtt actcaagagt gatagccaaa gttttaatag agactcaatt       660
     aataatgcaa ttttacgagc cgagcaaaaa atagctaatc gttcagtgac tgcatctgag       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page