(data stored in ACNUC7421 zone)

EMBL: CP000821.PE497

CP000821.PE497       Location/Qualifiers
FT   CDS_pept        611968..612678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0497"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI7"
FT                   /protein_id="ABV35110.1"
FT                   /translation="MSENIERRRFLKCLGASSLIIAPLGCSSVKEKESDANKPHYAMVF
FT                   DQNKCTGCGECKEACNLANNLPEGKSRLLLEQHSGGLEGQPCPHCGKTTECGCERKFVR
FT                   VSCQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIGACPYDARFINKETDV
FT                   ADNCDFCLHSKLAIGELPACVQKCRYDALIFGDINDPTSYVSKLLRVKDSVRVKPGFGT
FT                   EPSLRYIPIVKLGV"
     gtgagtgaaa acatagagag acggaggttc cttaagtgct taggagccag ctctttgata        60
     atagcgccct tagggtgcag ttcggtcaaa gagaaggagt cagatgcaaa caagccccat       120
     tatgcgatgg tgtttgatca aaataaatgc actggctgtg gtgagtgtaa agaggcctgt       180
     aatttagcga ataacttacc cgagggtaag tccaggttgc tgttggagca acattctggt       240
     gggctagagg ggcagccttg cccacactgc ggtaaaacaa ctgaatgtgg ttgtgaacgt       300
     aagttcgttc gagtttcatg ccagcagtgt aaaaatgccc cctgtgtcac cgtatgccca       360
     actggcgctg cgcaccggga tgagaaaacc ggtatcgtaa ctatggatgc gagcaaatgt       420
     gccggttgta aatattgtat cggtgcttgt ccttacgatg cgcgctttat caataaagag       480
     accgatgttg ccgataattg cgatttttgt ctacacagca aactggcgat tggcgagcta       540
     ccggcctgcg ttcagaagtg tcgctatgat gcattgatct ttggtgatat caacgacccg       600
     acatcctatg tcagtaagtt gctaagggta aaagactctg ttcgtgtgaa gcctggattt       660
     ggtactgagc caagtctgag gtacatacct attgttaagc tgggggtata g                711
//

If you have problems or comments...

PBIL Back to PBIL home page