(data stored in ACNUC7421 zone)

EMBL: CP000821.PE499

CP000821.PE499       Location/Qualifiers
FT   CDS_pept        613800..614288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0499"
FT                   /product="NosL protein"
FT                   /note="KEGG: son:SO0485 NosL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35112"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI9"
FT                   /protein_id="ABV35112.1"
FT                   /translation="MKKLILILLVIPVLFACSRGDAVTKSVEAQAIHDHERCHLCGMMI
FT                   TKYPGPKGQLQLKSEEIVPKFCSTRDMFNFSLQPENQRQITALMVHDMSATDWAHPDDK
FT                   HFIDATQAWYVYGTSRKAVMGPAVASFATEEGAVQFAKEFGGAVLGYEQITLELLLGE"
     atgaaaaagc ttattctcat cttgttggtt atcccggttc tttttgcatg tagccgaggt        60
     gatgccgtta ctaagtcggt agaggcccaa gctattcatg atcatgagcg ttgtcacctg       120
     tgtggcatga tgataacgaa atacccgggt cctaaggggc agttacagct aaaaagtgaa       180
     gagatagtcc ctaagttttg ttctaccaga gatatgttca acttctctct tcagcctgag       240
     aatcaacgtc agatcaccgc tcttatggtc catgacatgt cggcaaccga ctgggcgcat       300
     ccggatgata agcactttat cgatgcgact caggcctggt atgtatatgg gaccagcaga       360
     aaagcagtga tgggacctgc tgtcgcctcg ttcgccaccg aagagggggc tgttcaattt       420
     gctaaagagt ttgggggagc cgttttaggc tatgagcaga tcaccctcga gctacttctc       480
     ggcgagtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page