(data stored in ACNUC7421 zone)

EMBL: CP000821.PE5

CP000821.PE5         Location/Qualifiers
FT   CDS_pept        complement(4230..4367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0005"
FT                   /product="ribosomal protein L34"
FT                   /note="KEGG: shw:Sputw3181_4095 ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34618"
FT                   /db_xref="GOA:A8FP45"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP45"
FT                   /protein_id="ABV34618.1"
FT                   /translation="MSKRTFQPSNLKRKRSHGFRARMATVGGRKVLARRRAKGRARLSA
FT                   "
     atgagtaaac gtacttttca accaagcaac ctaaagcgta agcgttctca cggattccgc        60
     gctcgtatgg ctacagttgg aggccgcaag gtcctagctc gtcgtcgtgc taaaggtcgc       120
     gctcgtcttt ctgcttaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page