(data stored in ACNUC7421 zone)

EMBL: CP000821.PE501

CP000821.PE501       Location/Qualifiers
FT   CDS_pept        615611..616513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0501"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35114"
FT                   /db_xref="GOA:A8FQJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ1"
FT                   /protein_id="ABV35114.1"
FT                   /translation="MNTAVSARNISHNFGADVALDDVSFEMKQGQTMALLGHNGAGKST
FT                   LIKILLGLITPTGGVINILGRNIRKNTSRSDLKLGYLPENVSFYDKLTGEEILTYFAEL
FT                   KGVGKNRVCELIEEFGLGYAKDRALKTYSKGMKQRLGFAQAILCEPELLLLDEPTVGLD
FT                   PVASQFLYGKIDELKRLGCAVIVCTHELSLIENNIDTALILGKGRCLASGNLGELRYES
FT                   RLKTRLTSPSLAALVNDSERLASLYTDNALLLDSESKQDVVQYLTAECGLFDFALKEPG
FT                   LAEIYHFHMQKYSQLGVVS"
     atgaatactg ctgtttctgc cagaaatata agccacaatt ttggggctga tgttgcactc        60
     gatgatgtga gtttcgagat gaaacaaggg caaacgatgg cgttgctcgg tcataacggt       120
     gcaggtaaat ctaccctgat aaagatcttg ctcggtttga tcacacctac tggaggtgtg       180
     atcaatattt tagggcggaa tataagaaaa aataccagtc gttcggacct gaagttaggg       240
     taccttcctg aaaatgtgag cttttatgat aagttgaccg gcgaggagat tttaacctat       300
     tttgctgagc tcaagggggt aggaaaaaac agagtctgtg aattaataga ggagtttggt       360
     ttaggttatg ccaaagacag ggcattaaaa acctactcta aagggatgaa gcaaaggtta       420
     ggctttgccc aggcgattct ctgtgagccg gagttattgc tgctcgatga gcctaccgtc       480
     ggattagatc ccgttgcctc tcaatttctc tatggaaaaa ttgatgagct caagcggctt       540
     ggctgtgctg ttattgtctg tacccatgaa ttatcactca ttgaaaacaa tatcgatacc       600
     gcccttatct taggtaaggg tcggtgtctg gcatccggga acctcggcga actcagatat       660
     gagagtcggt taaaaacaag gttaacctct ccttcattag ctgcgttggt gaatgacagc       720
     gagcgattag cctctcttta taccgataat gcgctgttgc tggatagcga gagcaagcaa       780
     gatgtcgttc aatatttaac tgccgagtgt ggtctgtttg attttgctct gaaagagccg       840
     ggtttagccg agatctatca ttttcatatg cagaagtatt ctcagcttgg agtcgttagt       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page