(data stored in ACNUC7421 zone)

EMBL: CP000821.PE502

CP000821.PE502       Location/Qualifiers
FT   CDS_pept        616515..617345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0502"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35115"
FT                   /db_xref="GOA:A8FQJ2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ2"
FT                   /protein_id="ABV35115.1"
FT                   /translation="MLFHSSVLVIAKKEIRDSLRNRWVTFISLIFLLLSLSVTFAGSAV
FT                   VGQLALPKLDALISSLSTISVFIIPLAAMLVSYDAFIGEDESGTLLLLLSYPLSRFQIL
FT                   SGKLIGHSVIMSFTISFAFGLTAVLLLIFGDNYDVAATVGQFSQFILTSILLAITFILL
FT                   GYIVSLKATEKAKAVATVLFVWFLFVLIYDLLLLTLLVADISFFNQYIINVLIALNPTD
FT                   LYRAINLIGTDASKGSLATLSASGWGKIALYLVMGLWVSGLMLVANFVFKRRQL"
     atgttatttc actcatcagt attggtcatc gctaaaaaag agatccggga tagcctgagg        60
     aatcgatggg taacctttat ctcgcttatt tttttgcttc tctctcttag tgttacgttt       120
     gcaggtagtg ccgttgttgg tcaattggcg ttgccgaagt tggatgccct gatatcgagt       180
     ctatctacaa tttctgtatt tattattccg ttagcggcaa tgttagtcag ttacgatgcc       240
     ttcattgggg aggatgagtc cgggactcta ctgttattac tctcctatcc actgtccagg       300
     tttcaaattt tatcgggtaa gcttatcggg cacagtgtga ttatgagttt tactatcagt       360
     ttcgcttttg gactgacagc tgtgctcttg cttatattcg gtgataacta tgacgttgcc       420
     gccacagtcg gtcagtttag tcagtttatt ttgaccagca tattactcgc gatcacgttt       480
     attttactgg gctatattgt cagcttaaaa gcgactgaaa aagctaaggc ggttgcgacg       540
     gttctgtttg tttggtttct gttcgtgctt atctatgatc tcttgctgtt gacgctatta       600
     gttgccgata tttcattctt taatcagtat attatcaatg tcttaattgc actaaatcct       660
     acggatctgt atcgcgcaat taatcttatc ggtaccgatg cgagcaaggg gagccttgct       720
     acattatctg catcgggttg gggaaaaatc gcgctttatc ttgtaatggg tttgtgggtt       780
     tcaggtttga tgcttgttgc taacttcgtg tttaaacgta ggcagctata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page