(data stored in ACNUC7421 zone)

EMBL: CP000821.PE504

CP000821.PE504       Location/Qualifiers
FT   CDS_pept        complement(619041..619751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0504"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="KEGG: sbl:Sbal_0464 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35117"
FT                   /db_xref="GOA:A8FQJ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ4"
FT                   /protein_id="ABV35117.1"
FT                   /translation="MKTIRCKIEQVTPFNEAVYQIILKPETAFDFKAGQYLCVVMDEKD
FT                   KRPFSIASAPDAEHIELHIGAAVSESYPMQVVDRMQECLQNNATIEVEVPGGDAHLRHE
FT                   SQRPRLMIAGGTGFSYIKSIVEHQIALDLQVETTFYWGCRTQDAMYYETIAREWHDAHP
FT                   WMHFVPVLEQANDDWKGKQANLLDQIRTDFVSLNGYDIYIAGRFDMVGTARELFRTMGL
FT                   EEDHLYGDAFAFIK"
     atgaaaacga ttcgctgtaa gatagaacaa gtcaccccat ttaatgaggc ggtttatcag        60
     atcattctga agcctgaaac agcttttgac tttaaggctg gccagtatct ttgcgtcgtt       120
     atggatgaaa aagacaagcg tccattctcg atcgcttcgg cacccgatgc cgaacatatt       180
     gagctacata tcggtgccgc agtgagtgaa agctacccga tgcaggtcgt agatcgtatg       240
     caagagtgtt tacaaaacaa cgccactatt gaagttgaag tacctggcgg tgatgctcat       300
     ctgcgtcatg aaagtcaacg cccgcgcctc atgattgcag gcggtaccgg cttctcctat       360
     atcaagagta tcgttgagca tcagatagca ttagacctgc aagtggaaac tacattctac       420
     tggggttgcc ggactcagga tgccatgtat tacgagacta tcgcacggga atggcatgat       480
     gctcatccat ggatgcattt tgtacctgta ctcgagcagg ccaatgatga ctggaaggga       540
     aagcaagcta accttctgga tcagataagg actgactttg tcagcctcaa tggctatgac       600
     atctatatcg cgggtcgttt cgatatggtg ggaacggcgc gggaactgtt ccgcactatg       660
     ggactggaag aagatcacct ctacggcgat gccttcgcgt ttattaagta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page