(data stored in ACNUC7421 zone)

EMBL: CP000821.PE506

CP000821.PE506       Location/Qualifiers
FT   CDS_pept        621781..622272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35119"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ6"
FT                   /protein_id="ABV35119.1"
FT                   /translation="MSQLSRVRRAVILCGLLSLSSLSAQASDRFNWSSNVWVQPTWSSS
FT                   WGHHYPNYNSGWRWGVGVSTGSPYWNNHGYYWNRPWYRPYWRNNWGYPYRYDRREYKRP
FT                   EPKVIAPPQRVTTSVQYASGLKSLPENARVMQRDGRTIYEWQGIEYVFDWSSETYRELR
FT                   "
     atgagtcaat tatctcgtgt tagacgggct gttatcttgt gtggtttgct gtctctttca        60
     agtctaagtg cacaagcttc tgatcgcttc aattggagca gtaatgtgtg ggttcaacct       120
     acctggagca gtagctgggg tcatcactat ccaaactata atagtggttg gcgttggggt       180
     gttggagtca gcacaggatc accttactgg aataatcacg gctattattg gaacagacct       240
     tggtatcgcc cttactggcg taacaactgg ggctatcctt atcgctacga tcgtagagag       300
     tataagcgtc ccgagcctaa agtcatagca ccaccacaga gagtgaccac cagtgtgcaa       360
     tacgcatctg gcctgaaaag cttgcctgaa aatgcccggg tcatgcaaag agatggccgc       420
     accatctatg agtggcaagg gatcgagtat gtgttcgatt ggagcagcga gacctatcga       480
     gagttgaggt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page