(data stored in ACNUC7421 zone)

EMBL: CP000821.PE507

CP000821.PE507       Location/Qualifiers
FT   CDS_pept        622689..622946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0507"
FT                   /product="toxin secretion, membrane fusion protein"
FT                   /note="KEGG: son:SO_A0050 toxin secretion, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35120"
FT                   /db_xref="GOA:A8FQJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ7"
FT                   /protein_id="ABV35120.1"
FT                   /translation="MTGIFRRQAVEAQKNKLHGDISLAQPLSIYSVVLALLAIVVATSI
FT                   FLSFSNYARKETVRGYIVPDKGVIKTHASRSGNVMLIILS"
     atgactggaa tattcagaag gcaagccgta gaggctcaaa aaaataagtt gcatggtgat        60
     atttcactgg cgcaaccctt gtcaatttat agtgtcgttc ttgcacttct cgctattgtt       120
     gtagccacat ccatttttct ctctttttca aattatgcac gtaaggaaac ggttagaggc       180
     tatatcgttc cagataaagg tgtaataaaa acccatgcaa gccgaagtgg gaatgtaatg       240
     ttaataattt taagttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page