(data stored in ACNUC7421 zone)

EMBL: CP000821.PE508

CP000821.PE508       Location/Qualifiers
FT   CDS_pept        623989..624969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0508"
FT                   /product="putative CheW protein"
FT                   /note="KEGG: sbl:Sbal_3194 putative CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35121"
FT                   /db_xref="GOA:A8FQJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ8"
FT                   /protein_id="ABV35121.1"
FT                   /translation="MNDLKKSEILTESGTNELEIIEFHLHKLLPDGGFKVCHYGINVAK
FT                   VREVILVPSTSDYPNAQPHMVGVFSLRDILIPLVDLAGWLGIPTKDDLTHKVVIVTDFN
FT                   KMINGFLIDSVRSIHRVSWEQVESPSQFLEAGEQDCVVAVVRREGHLIMVLDFEKIIAD
FT                   INPELSMDKYDVLQDKSVIIDDTMLAKREAKTILVVDDSAFIRKMIENTLRSAGYNIIT
FT                   AKDGGDALEMLLEYERLAVDEGASVNDFVSAIITDVEMPRMDGMHLVKRLRDTSAYSNM
FT                   PIVMFSSLMSEDNRSKALQLGANDTITKPEIGRMVGMMDGYVLDD"
     atgaatgact tgaaaaaatc tgagatcctt accgagagtg gtaccaacga gctcgaaatt        60
     atcgagtttc atctgcataa attactcccc gatggcggtt ttaaagtatg tcattacggg       120
     attaatgtgg ctaaggtgcg tgaggtgatt ctggtgccga gcacatctga ttatcctaat       180
     gctcagccgc atatggtggg tgtattttcc ttaagggata tcttgatccc cttggtagat       240
     ctggccgggt ggcttgggat cccgacgaaa gatgacttga ctcataaggt tgtcattgtc       300
     accgacttta acaagatgat taatggtttt ttaatcgata gtgttcgcag tattcatcgg       360
     gtgtcatggg agcaggtcga atcccccagt cagtttttag aggcgggcga acaggattgt       420
     gtcgtcgccg ttgtcaggcg ggaggggcat ctgattatgg tgttggattt tgagaaaatc       480
     atcgcagata tcaatccgga attgagtatg gataaatatg atgtacttca ggataagagt       540
     gtcattatcg acgataccat gctggctaag cgtgaagcta agaccatact ggttgtcgat       600
     gattccgcgt ttatccgtaa gatgattgaa aatacattga gatcggctgg gtataacatt       660
     attacagcga aagatggtgg cgatgctctc gagatgttac tggaatatga gcgtttagcc       720
     gtcgatgagg gggcttcggt taatgatttc gtcagtgcca tcattaccga tgtggagatg       780
     ccccgcatgg atggtatgca cttagtgaag cgcctgcgtg atacgagtgc ctatagcaat       840
     atgcctattg taatgttctc gtctctgatg agtgaggata accgcagtaa ggcgttgcaa       900
     ctcggcgcga acgacaccat aactaagcca gagatcggtc gcatggtcgg tatgatggat       960
     ggctacgtgc tcgatgatta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page