(data stored in ACNUC7421 zone)

EMBL: CP000821.PE51

CP000821.PE51        Location/Qualifiers
FT   CDS_pept        complement(63481..64203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0051"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="KEGG: shw:Sputw3181_0490 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34664"
FT                   /db_xref="GOA:A8FP91"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP91"
FT                   /protein_id="ABV34664.1"
FT                   /translation="MNSGQLAYQEASDEQVPNRLSENQVMSQYLPLVKRSISQLRSHCG
FT                   TVLAIEDMEQIGMMALLESSRRYPGEYDNGFISYAGQRIRGAILDELRRQDWRPRPVRQ
FT                   QAHELNDTVRKLTRLLGREPSDIEVAEAMGLNREEYRERLYASQSESMKSLDDMLSVGA
FT                   HFPDKTNVIEQFSVQKTLIKAISKLSKREQLILSLYYQHELNLKEIAGTLGLTETRICQ
FT                   LHKQAVKHLQEIYQQWER"
     atgaattcgg gtcaattagc ctaccaggaa gcaagcgatg agcaagtccc caatagactc        60
     agcgaaaatc aagtgatgag tcaatacctg cctcttgtga agcgttctat ctctcagctt       120
     agaagccatt gtggaacggt actcgccata gaagatatgg aacagatagg aatgatggca       180
     cttctcgagt catcacgccg ttatccgggt gaatatgata acgggtttat ctcctatgcc       240
     ggtcagcgta ttcgaggagc aattcttgat gagttaaggc gtcaggattg gcgtccccgt       300
     cccgtcagac aacaagccca tgagctgaat gatacggttc gaaagttaac tcgtttactt       360
     gggcgagagc cgagtgatat cgaagtggct gaggccatgg ggctcaacag agaggaatat       420
     agagagcgcc tctatgcctc acaatctgaa tcgatgaaga gtctggatga catgttgagt       480
     gtcggtgctc actttcccga taaaaccaat gtcattgagc aattttccgt ccaaaagaca       540
     ttaatcaaag caatatccaa attaagtaaa agagaacagc taattctgtc gctttattat       600
     caacatgaac tcaatttaaa agaaattgca ggaacactgg gattaactga aacgcggatt       660
     tgtcagctcc acaagcaggc agtgaaacac cttcaagaga tctatcaaca gtgggaacgt       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page