(data stored in ACNUC7421 zone)

EMBL: CP000821.PE511

CP000821.PE511       Location/Qualifiers
FT   CDS_pept        627002..628204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0511"
FT                   /product="putative tyrosine-specific transport protein"
FT                   /note="KEGG: ppr:PBPRA2465 putative tyrosine-specific
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35124"
FT                   /db_xref="GOA:A8FQK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK1"
FT                   /protein_id="ABV35124.1"
FT                   /translation="MNKSKIFGSMLIIAGTTIGAGMLALPLASSGLGFGVASIIMLLIW
FT                   SLMTYTALLMIEVHQFAPADATLHTLAYKLLGRKGQLIASFSMMFLFYALCAAYIAGGG
FT                   EQIHSKLTSWFELDIPMQLGAILFTVLIGTVVAIGTRSVDMINRSLFSLKLIALVLMLF
FT                   LLLPHVSVDNLVALPVHQGLVLASLPVIFTSFGFHGSIPSIVRYLGKDTKALRWIIVVG
FT                   SALPLAVYLLWMLASQGVLTQGDLMGSQSLNGFIGSLSRLLHDPMIANTVSIFADLALA
FT                   TSFLGVSLGLYDFIADLLKRSTKPSHRVQVALVTFMPPLGFAMFYPQGFIAALGYAAFA
FT                   LVVLAIFLPVAMVSTQRRQVGLGGYRVRGGALGLGLVTLAGILIMTVQLLQMFDALPAV
FT                   G"
     atgaataaaa gtaaaatctt cggtagcatg ctcataattg ccggcacgac cataggtgcg        60
     ggtatgttag ccctgcctct tgcctcctcg ggtctgggct tcggtgtcgc gagtattatt       120
     atgctgctca tctggtctct tatgacctat accgcattgc tgatgatcga agtgcaccaa       180
     tttgcccccg ccgatgcgac cctacacacc ttggcgtata aactgctggg ccgaaaaggg       240
     cagctcattg ccagtttctc gatgatgttt ctgttttatg cgttatgtgc ggcctatatc       300
     gccggtggcg gtgagcagat ccatagtaag ctcacaagct ggtttgagct ggatatccct       360
     atgcagttgg gggcgatact cttcactgtg ttaattggta ctgttgtggc gattggtact       420
     cgctctgtcg atatgattaa ccgcagctta ttttccttga agttaattgc cttagtcttg       480
     atgttgttcc tgcttttgcc tcacgtgtct gtcgataact tagtggcgct gcctgtgcat       540
     caagggctcg tattagcctc attgcctgtg attttcacct cgtttggttt tcatggttct       600
     attccatcta tcgtgcgtta cttagggaag gatactaagg cattgaggtg gatcattgtg       660
     gtgggatcgg cactgccgct ggcggtttac ctcttatgga tgctggccag tcagggggtt       720
     ctgacacaag gtgatttaat ggggagtcaa agcctcaatg ggttcatcgg ctctctgagc       780
     cgcctgctgc atgaccctat gatagcgaac acggtatcga tatttgccga tctcgctctg       840
     gctacctcat ttcttggtgt cagtttaggc ttatatgact ttattgcaga cctgttgaag       900
     cgcagcacta agccgagcca tagagttcag gtcgccctgg tgacatttat gccgccattg       960
     ggatttgcga tgttttaccc tcaagggttt atcgcagctt taggctacgc ggcatttgcg      1020
     ttagtggtac tggcgatctt ccttccggtg gctatggtat cgactcagcg cagacaagtc      1080
     gggttaggtg gctaccgcgt taggggcgga gcattgggac tcggattagt gaccttagcc      1140
     ggtattttaa tcatgacggt gcaattgttg cagatgtttg atgctttgcc tgctgtcggc      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page