(data stored in ACNUC7421 zone)

EMBL: CP000821.PE512

CP000821.PE512       Location/Qualifiers
FT   CDS_pept        629048..629992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0512"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35125"
FT                   /db_xref="GOA:A8FQK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK2"
FT                   /protein_id="ABV35125.1"
FT                   /translation="MKKIDHLDSFTLSVFVELYEQKSGTAAAAKLAITQSKVSRTLTSL
FT                   RHIFENELFIRQQHGMKPNHLADRLYPLAKTLVANYQSLAHTMEITVAENKAVNIAAQG
FT                   NFHNIIFDCLNQVTIGEGSPFSFELHTITSDFQKKLVNGVFDYCISINPAQADGITRYE
FT                   IGEIGRYFLVAKKGHPIFNSKITLENILKYKVAISNYALDEQKMPRIDKIAYQKKLPIT
FT                   VALKISDLKLLLDYLELGDCVGLVAGSVFLHTLQERPELEFLDITELSTNLFSETSTYK
FT                   ELKYYLQANDSSDHILALKLAEKLREHFSYDNQ"
     atgaaaaaaa ttgatcatct tgattccttc acattatccg tatttgtaga gctttatgaa        60
     caaaagagtg gaaccgctgc agccgcaaaa ttagcgataa ctcagtcaaa agtaagccga       120
     acgttgacgt cccttcgtca tatttttgaa aatgaactgt ttattagaca gcagcatggc       180
     atgaaaccaa accatctggc agaccgactc taccctctgg ccaaaacgtt agtcgcgaac       240
     taccagtctc tggctcatac catggagatc accgtagcag aaaacaaggc ggttaatatt       300
     gctgctcagg ggaattttca caacataatt tttgactgct tgaatcaagt tactatcggt       360
     gaggggagcc cgttttcttt cgaactacac acaattacat cagactttca gaaaaaattg       420
     gttaacggtg tttttgatta ttgtatatcc atcaaccctg cccaagcgga cggcatcacc       480
     cggtatgaaa taggagaaat aggccgctat ttcttggtcg caaagaaagg gcaccctatc       540
     ttcaattcta aaatcacatt agagaacata ctcaaatata aagtagccat atcaaattat       600
     gctttagacg agcagaaaat gccccgtatc gataagattg cctaccagaa aaaactccca       660
     atcaccgttg cactaaaaat ttctgacttg aaactgctgc tcgattatct tgagcttggt       720
     gactgtgtag gattggtggc aggatcggtt ttccttcata cgctgcaaga aagaccggag       780
     cttgagttcc tcgacattac tgaattatca actaacttgt ttagtgagac atccacctac       840
     aaagaactta aatattattt acaggcaaat gactctagtg atcatatttt agcattaaag       900
     ttagctgaga agttacggga gcatttttct tatgataacc agtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page