(data stored in ACNUC7421 zone)

EMBL: CP000821.PE514

CP000821.PE514       Location/Qualifiers
FT   CDS_pept        631488..632033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35127"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK4"
FT                   /protein_id="ABV35127.1"
FT                   /translation="MRKLLITASLALLLSACGSDDDVSVEPIDPVDPVVPVEPTDPISA
FT                   SVTIDQANEIDVIISSVDPQSFAIAFTLTDADNQAITDAGSDFEVMYLSMPAEITSAFS
FT                   MPWHNASKFGCDAEESDCIDTLVEVSPGSYTFTPASQPVFNMDTQTLRLSVMVAGALAQ
FT                   SKPEIVKPIGDHFWLPTS"
     atgcgtaaat tacttataac cgcttccctg gcattgctgt tgtcagcctg tggctcagat        60
     gatgatgtga gcgttgagcc aattgatccg gttgatccag ttgttccggt tgagccgact       120
     gatcctatat ctgccagtgt caccatagat caggctaacg agattgatgt catcatcagc       180
     tcggttgatc ctcaaagctt tgccatcgcc tttaccttga ccgatgcaga caaccaggcg       240
     atcaccgatg ccggtagtga tttcgaggtg atgtacctga gtatgcctgc cgagataact       300
     tcggcgttta gcatgccctg gcataatgcc tcaaaatttg gctgcgatgc agaagagtct       360
     gattgtatcg atacactggt tgaagtgagt ccgggctctt atacctttac tcctgccagt       420
     caacctgtct tcaatatgga tactcaaact ttaaggctat ctgttatggt tgctggcgcg       480
     ttagctcaaa gcaaaccaga aatagtaaaa cctataggcg atcacttttg gttaccgacg       540
     agttag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page