(data stored in ACNUC7421 zone)

EMBL: CP000821.PE515

CP000821.PE515       Location/Qualifiers
FT   CDS_pept        complement(633107..633397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35128"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK5"
FT                   /protein_id="ABV35128.1"
FT                   /translation="MLRILGLTFLLILSGYVLAEPIAETHAEMSGCESCHINGEPSDDM
FT                   VHENSSCVECHGPLSDFADETHQRHHDVLECSNCHLAHDEVKLNDSCVNCH"
     atgcttagaa ttttaggatt aacatttcta ttaatattat caggttacgt acttgcagaa        60
     ccaatagctg aaacccatgc tgaaatgagt ggttgcgaat cttgtcatat taacggtgaa       120
     ccatctgatg acatggttca tgagaatagt tcatgtgttg agtgtcatgg tcctttgagt       180
     gactttgctg acgaaacgca ccaacgacac catgatgttt tagaatgcag taattgtcac       240
     cttgctcacg atgaagtaaa acttaacgat tcttgcgtta attgtcacta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page