(data stored in ACNUC7421 zone)

EMBL: CP000821.PE516

CP000821.PE516       Location/Qualifiers
FT   CDS_pept        complement(633420..634361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0516"
FT                   /product="formate-dependent nitrite reductase, nrfD
FT                   protein"
FT                   /note="KEGG: son:SO4568 formate-dependent nitrite
FT                   reductase, nrfD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35129"
FT                   /db_xref="GOA:A8FQK6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK6"
FT                   /protein_id="ABV35129.1"
FT                   /translation="MNPFHFDSLVWHWPIAIYLFLAGISAGAICFAVLLKHFKLGKSAY
FT                   KSSFVQAACLLAPLAVFAGLGILVLDLTKPFDFWKILVFYNPTSIMSVGVAVLMIYQVA
FT                   LFSWLACLFKEPISNWCDHRWPLIDRILNILDKHEPSITGLLVMLALSLGAYTGFLLSA
FT                   LTTFPMLNNPVLPMLFLVSGISSGAAGTLLGGLLLKGNPDSKEVHFIHHIEIPIILFEL
FT                   VLLFTFFIGLIISGGQSQAAALTALGEGFWGWVFWAGIIVIGLTLPLAFNLFMTASSKR
FT                   KLSYVAITASCSLLGVLLLRNFILYTGQMTVA"
     atgaatccat ttcactttga tagccttgtt tggcattggc ctatcgcaat ctaccttttt        60
     ttagcaggta tatcggccgg agctatttgt ttcgccgtat tactaaagca ctttaaatta       120
     ggtaagagtg cttacaaatc aagttttgtt caagcagctt gtctacttgc accactagcc       180
     gtatttgccg gtcttggcat actagttctc gatttaacta agccatttga tttctggaaa       240
     attttagtat tttacaatcc gacttcgatt atgtctgttg gagttgctgt gctaatgatt       300
     taccaggtag ccctattctc atggttagct tgcttattta aagagcctat ctccaattgg       360
     tgtgaccatc gatggccatt gatagataga atattaaata tattagataa gcatgagcct       420
     agcatcactg gattgctagt tatgctagct ctatctttag gtgcttatac gggcttttta       480
     ctttctgcat tgaccacttt tcctatgctc aacaatcctg tactacctat gttatttctt       540
     gtttctggta tttcttcagg ggctgcagga accttgttag gtggattact cctcaagggg       600
     aaccctgata gtaaagaagt tcattttatt catcacattg aaatacctat aattttattc       660
     gaactggttc tgctttttac cttcttcatt gggttgatta tatctggcgg acagagccaa       720
     gcagcggcac ttacggcgct cggggaaggt ttctggggat gggtattctg ggctgggatc       780
     attgtaatag gcttaacact accgctcgcc ttcaatttat ttatgacagc ctcttctaaa       840
     cgaaaactat cttatgtcgc tattacagct agttgcagtt tattgggcgt tttactgctt       900
     cgtaacttca ttctttacac tggtcaaatg actgtcgcat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page