(data stored in ACNUC7421 zone)

EMBL: CP000821.PE517

CP000821.PE517       Location/Qualifiers
FT   CDS_pept        complement(634358..635047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0517"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: shw:Sputw3181_3894 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35130"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK7"
FT                   /protein_id="ABV35130.1"
FT                   /translation="MENKRRLFLKCACATAVGAVGSTKLIAAQSDTKTDDTEAEVNYAL
FT                   IHDETKCIGCEVCVDACRETNNVPEGVSRLEIVKTGPFGEYPDQYFSFSRKSCQQCDGT
FT                   PCVNVCPTGAAYKDPKTGIVSVDSWKCVGCMYCIAACPYQVRFINPVTKAADKCDFCKE
FT                   TRLKEGKSPACVAACPTKALVFGNLKDPDSEIVKVLKTTPNYRSKTDLGTRPKLFRIAA
FT                   KNGEIKL"
     atggaaaata aaagaagact ctttttaaaa tgtgcttgtg ccacagcggt cggagcggtt        60
     ggatcaacaa agcttatagc agcccaatca gatactaaaa cagatgatac cgaagccgag       120
     gtcaattacg cactcattca tgatgaaact aagtgcattg gttgcgaagt gtgtgttgat       180
     gcctgtcgtg aaacgaacaa tgtacccgaa ggtgtaagca gattagagat tgttaaaact       240
     ggcccatttg gtgagtatcc tgatcagtac tttagcttct ctcgcaaatc atgtcagcaa       300
     tgtgatggaa ctccctgtgt caatgtctgc ccaacagggg ctgcgtacaa agatcctaaa       360
     acaggcattg tctcagtaga cagttggaaa tgtgttgggt gtatgtactg cattgccgca       420
     tgtccatatc aggtccgatt tatcaaccct gttaccaaag ccgctgataa atgtgatttc       480
     tgtaaagaaa ctcgtcttaa agaaggaaag tcacctgctt gtgtcgctgc ttgcccaaca       540
     aaagcgcttg tctttggcaa cctaaaagat cctgattctg aaatcgttaa ggttctaaaa       600
     acgacaccaa attatcgaag taaaacagat ctgggaactc gtccaaaact attccgtatt       660
     gcagcaaaaa atggggagat aaagctatga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page