(data stored in ACNUC7421 zone)

EMBL: CP000821.PE518

CP000821.PE518       Location/Qualifiers
FT   CDS_pept        complement(635060..635530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35131"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK8"
FT                   /protein_id="ABV35131.1"
FT                   /translation="MSSFKKVFTLSILTLTTFISTPLSISYANTLELTINTNKQCIMCH
FT                   KKNGKMFGIHSSNSLELRCQNCHREKEGHPRKKSSLIKFSDHSLNTAEEQTAVCTTCHN
FT                   SDDLTEVDWTHAVHSNKVNCAKCHQLHTETDPVIAISTGERRQLCVNCHESR"
     atgtctagtt ttaaaaaagt tttcaccctc tctatactga ctttgactac atttatttca        60
     acgccacttt ctatttctta tgcaaacacg cttgagttaa caatcaacac caacaagcaa       120
     tgcatcatgt gccataagaa aaatgggaaa atgttcggca ttcattctag caactcatta       180
     gagttacgtt gccaaaattg ccacagagaa aaagaaggtc acccaaggaa aaaatcaagc       240
     ctaataaaat ttagtgacca ttcactcaac acagctgaag agcaaaccgc agtttgcact       300
     acatgccata actccgatga tttaaccgaa gtagattgga ctcatgcagt tcactcaaac       360
     aaagttaatt gtgctaagtg ccatcaatta catactgaga cagatccagt tattgcaatt       420
     tcaacaggtg agcgccgtca gctatgcgtt aactgccatg aaagccgata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page