(data stored in ACNUC7421 zone)

EMBL: CP000821.PE519

CP000821.PE519       Location/Qualifiers
FT   CDS_pept        complement(635613..636107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35132"
FT                   /db_xref="GOA:A8FQK9"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK9"
FT                   /protein_id="ABV35132.1"
FT                   /translation="MNATVIFNYAFMYFVLFLVVPSVIIVFAMTCIKFFKSEKIQTEGV
FT                   IIELTPEKTKAKFSALTARLNEIARGKYNVLYGASLGSILDVKSDNNHHTYENIKNCQL
FT                   DYVILDEQSSVKLVITDPEHNTPENSDFIDSSLAKVGVNVIHISDNKQCDDLLVRELLV
FT                   A"
     atgaacgcaa cagtaatatt taactatgct ttcatgtact ttgtactatt tctagttgtc        60
     ccatctgtca tcattgtatt tgcaatgaca tgcattaagt tttttaagtc tgaaaaaata       120
     caaactgaag gagtaattat tgaattgact ccggagaaaa caaaagcaaa gttttcagca       180
     cttacagcaa ggctaaatga aatagcaaga ggtaagtaca atgtgttata cggagcatct       240
     ttgggtagca ttctcgatgt aaaaagtgac aacaatcatc atacatatga aaacattaaa       300
     aattgtcagt tagattatgt aatactagac gaacaatcat cagtaaagct ggtcattaca       360
     gatcctgaac ataacacacc ggaaaatagt gactttatag attcatctct agctaaagtt       420
     ggtgtaaatg ttatccacat atcggataac aagcaatgtg acgacttatt agtaagagag       480
     ttgttggttg cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page