(data stored in ACNUC7421 zone)

EMBL: CP000821.PE52

CP000821.PE52        Location/Qualifiers
FT   CDS_pept        complement(64214..64672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0052"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="KEGG: sdn:Sden_3634 flagellar basal body-associated
FT                   protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34665"
FT                   /db_xref="GOA:A8FP92"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP92"
FT                   /protein_id="ABV34665.1"
FT                   /translation="MAFGNSSVSKKFSFTFVILLWSAGIFWVGWQSPSIIGGPFVTQEK
FT                   ESNTAKFYPLDRFVISVPGDKYPHYLLLEMALKSSSPNVSRTLKEADPLVRNSLMKMFS
FT                   RKHFNQLNDSHQLEALQKEALVLLSGVLSDNHYSIELEDVLFTRMVIQ"
     atggcatttg gtaatagtag cgttagcaaa aaattttcat tcacgtttgt tattctttta        60
     tggagcgctg gaatattttg ggtcggatgg caatcaccaa gcattattgg cggcccattt       120
     gtgactcagg aaaaagaatc gaatacagca aagttttatc cattagaccg atttgtaatc       180
     tccgtaccag gagacaagta cccccactat ctgctgcttg agatggcact taaaagcagc       240
     tcaccaaatg taagtcgtac tctgaaggaa gccgatcccc tcgtcagaaa ttcactaatg       300
     aagatgtttt cccgaaaaca ttttaaccag ctcaatgact ctcatcagct cgaagcgctc       360
     caaaaagagg cgttggtcct gctttcaggg gtactgtccg acaaccatta ctccatagaa       420
     ctcgaagatg tgctcttcac tcgtatggtt attcagtaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page