(data stored in ACNUC7421 zone)

EMBL: CP000821.PE521

CP000821.PE521       Location/Qualifiers
FT   CDS_pept        complement(637776..638084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35134"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL1"
FT                   /protein_id="ABV35134.1"
FT                   /translation="MPKNTLSRSLSYTDWYNIRPPFDGEVYVKENDWKFYLGDTIWAPE
FT                   HNKVGKWRMTLELKGKVIAEKTFKVHLNDELPRQTNKSIQMDDDAEKIASFWKRRGC"
     ttgccaaaaa acacgctgag tagatcactt tcttatactg attggtataa catcaggcca        60
     ccattcgatg gtgaggttta cgtcaaagag aatgactgga aattctatct cggcgatacc       120
     atctgggcgc cggagcacaa caaggtcggc aagtggcgca tgacactaga actgaagggg       180
     aaagtcattg ccgagaagac cttcaaagtt catctgaacg atgagcttcc acggcaaacc       240
     aataagagta ttcaaatgga tgatgacgca gagaagattg catcattttg gaaaagaaga       300
     ggctgttag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page