(data stored in ACNUC7421 zone)

EMBL: CP000821.PE522

CP000821.PE522       Location/Qualifiers
FT   CDS_pept        638859..639029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35135"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL2"
FT                   /protein_id="ABV35135.1"
FT                   /translation="MTKKTVKFEYEKETKNSVRYQEVPESGQAPIMGTVYVQKWFAGDT
FT                   KRFEITIEKQD"
     gtgactaaga aaaccgtaaa gtttgagtat gaaaaagaga ccaagaatag tgtgcgatat        60
     caagaggtcc cagaatctgg ccaggcgccg atcatgggca cggtttacgt acaaaagtgg       120
     tttgcaggtg ataccaagcg gtttgagata accattgaga agcaagatta g                171
//

If you have problems or comments...

PBIL Back to PBIL home page