(data stored in ACNUC7421 zone)

EMBL: CP000821.PE523

CP000821.PE523       Location/Qualifiers
FT   CDS_pept        complement(639199..640302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0524"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="KEGG: vfi:VF0872 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35136"
FT                   /db_xref="GOA:A8FQL3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL3"
FT                   /protein_id="ABV35136.1"
FT                   /translation="MLFNNGLKQENAALKQQLQELKDKHDQEIKELVEELKRKDFEHNK
FT                   LHQEQQLDATLITSNLRGGRMLETIRTGLANSAEELIHENEELKQLDEMFAQTHTALSQ
FT                   LEARAQKISEQTDSTMNSATALDETAKSIGQLIVAIQDISSQTNLLALNAAIEAARAGE
FT                   AGRGFAVVADEVRTLAGNAHEASDKIERLVNRVLGQTHEIKTSISENQLYAADISASSE
FT                   QIDVIVKEVLSKSQHMQKVIHLATARSFLDTVKLDHAVWKNNVYSHLQERDYQAQVNKH
FT                   TECRLGKWYFEGAGAEQYSHLASFNGLNQPHQLVHDSGHHAIQAGQSGDQHALIKHVEA
FT                   MEDASEGVVHSIDRLLGEVTSEQRRAL"
     atgctattca ataacggact aaaacaagag aatgcggcat taaaacagca gcttcaggaa        60
     ttgaaagata agcatgatca agagataaag gagcttgtcg aagagttaaa aagaaaggat       120
     ttcgaacata ataaattaca tcaggagcaa cagctcgacg ccactctgat aacgagtaac       180
     cttaggggcg gaagaatgct ggaaaccatc cgcacaggac tcgcgaatag cgctgaagag       240
     ctgatccatg aaaatgaaga gctcaagcaa ctcgatgaga tgtttgccca aacccataca       300
     gcactcagcc aacttgaagc ccgcgctcaa aaaataagtg aacaaaccga tagcacgatg       360
     aactcagcga cggccttaga tgagacggct aaatcaatag gccagcttat cgtcgcgata       420
     caggacattt cttcgcagac taacctgctt gcgcttaatg ccgccattga ggccgcacgt       480
     gccggcgaag ccggacgagg ctttgccgtg gttgccgatg aggtgcgcac cctcgcgggg       540
     aatgcccacg aggccagtga caagatagag agactggtca atcgagtttt agggcaaact       600
     catgagataa aaacatcaat tagtgaaaac caattgtatg cagctgatat atcggcatct       660
     tctgaacaga tagatgttat cgtcaaagaa gtattatcca agtctcaaca tatgcagaaa       720
     gttatccact tagcgactgc tcgctcgttc ctcgataccg tcaaactaga ccatgcggta       780
     tggaaaaata acgtctatag ccatctgcaa gagcgagact atcaagccca agtgaataag       840
     cataccgaat gccgtttagg taagtggtat ttcgagggcg cgggagccga gcagtacagc       900
     cacctggcaa gcttcaatgg cttaaatcag cctcatcagc tggttcatga ctccgggcat       960
     catgcaattc aagcgggtca gagtggtgat caacatgcat tgattaaaca tgttgaagcg      1020
     atggaggatg ccagtgaggg cgtagttcac tctatcgatc gcctgctcgg cgaagtcacc      1080
     agtgagcaac gcagggcttt ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page