(data stored in ACNUC7421 zone)

EMBL: CP000821.PE525

CP000821.PE525       Location/Qualifiers
FT   CDS_pept        complement(641660..642463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4008 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35138"
FT                   /db_xref="GOA:A8FQL5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL5"
FT                   /protein_id="ABV35138.1"
FT                   /translation="MSAQQSGMVCNRIIESFLEKLAPFGIKRFYYCIIPDELSNVCIVT
FT                   DDQANILNSDGNEELHIAKMIDLKKMRFAVASDPEILKFREEFLHRFARNDEGYQLSGP
FT                   SIRKKYNPYIWPENTMPERRKRSFEQLLNLYQIRTRISFYHPVKDKKGWIGICNLFSSD
FT                   KRGQVIDNISSTPDELETLLREFAETFNALAFKTINPISNFRVLSPTCVEILSLVAQGC
FT                   SSEEVGKQLYMSERGVNYHLDRARVILTARNRTNLVSKAYQSGLL"
     atgtctgcgc aacagagtgg aatggtctgt aacaggatca tcgagagctt tctcgaaaaa        60
     ctggcaccct tcggtattaa acggttttac tattgcatta ttccggatga actatccaat       120
     gtttgtattg tgaccgatga ccaagccaat attctaaaca gcgacggtaa cgaagaactt       180
     cacatcgcta agatgatcga tctgaagaag atgcgttttg ccgtcgcctc agatccggag       240
     atcttaaagt tccgcgagga gtttctacat cgttttgcca gaaatgatga aggctaccaa       300
     ctctcaggcc cctcaatccg gaaaaaatat aacccctata tatggccgga aaacaccatg       360
     ccggagcgac gaaaacggag cttcgagcaa ctactaaatc tataccaaat acgaaccaga       420
     attagctttt atcacccggt aaaagataaa aaaggctgga tagggatctg taaccttttc       480
     tcatccgata agcgaggtca agttatcgat aacatctcat cgacaccaga tgaattggag       540
     acgcttctca gggagtttgc cgaaacattt aatgccttag cgtttaagac catcaacccc       600
     atctctaatt tcagagtact atcccctacc tgcgtagaga tactctcatt agtcgctcag       660
     gggtgttcga gtgaagaggt aggtaaacaa ctctatatga gcgaacgggg tgtcaactat       720
     cacctggaca gagcaagagt tattctaacg gccagaaacc ggacaaacct agtcagtaag       780
     gcctatcaga gtgggttatt atag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page