(data stored in ACNUC7421 zone)

EMBL: CP000821.PE526

CP000821.PE526       Location/Qualifiers
FT   CDS_pept        complement(642520..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35139"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL6"
FT                   /protein_id="ABV35139.1"
FT                   /translation="MMKRNSIIAVLALSFALGGCGSDDSPTPEPPIPPEPPIVKPDYVF
FT                   GGPTEDEQKLNKVIQFAIVKGFSPLDDSDEAKKSKAKSYSSGHEIEGVLESKMVADAAK
FT                   LGLKVDYLLPPTAINMSGVKIDSIRPDIFQDGRGSVMDLLLWAAKKYNLDIEYEKDENL
FT                   KTHFITSIEGITGLPEVVDQDNLGKTEGQGWKYLVGPSIWEHKKEGSYETESYYYKEEE
FT                   IYFRMDHHPLKNEMSIVLVAAQPGEMDIRKKKYQKEMDRLAENGGKVIIPEIVIDFKPA
FT                   KTTETGEILIPNQRAVFKDIEVTPHNLRSDIYKEGTITELDAWLSLVEQRPDLKIDWSY
FT                   WPRLSTNSNVQGYVATAISFNGRDDVGNIVNERYTNNGSCGFVHHTGEWENYMDSGAQN
FT                   GLYQWVMCSARTDMGGDEYRKACYGQIPGILGYRARNYGEGEQFENHNPKGRGYMKFGL
FT                   PFGGNDPHLTGDAMIIYGPEYINYIGAAFGNGYGNQESTSGCDAEAPEIDPTRIKDISQ
FT                   ARAPLTPSHFGWKIPDCTTCHNAANSHVVQDMAPWECAECHGNNGAPDSHGELLTCGFC
FT                   HAKTLAKHGDAYSTKDDYYSEQTNFKEPESCLTCHVEKQEGTQ"
     atgatgaaac gcaattccat tatagcggtg ttagccctta gttttgccct cggtggctgt        60
     ggcagcgatg actcccccac cccggagcca ccgatcccgc cggagccgcc gattgtaaag       120
     ccagattatg tttttggtgg ccctactgaa gatgagcaaa agctaaacaa ggtgattcag       180
     tttgctattg taaaaggatt cagcccactc gatgattctg acgaagccaa gaagagcaag       240
     gccaagagtt actccagtgg tcatgagata gaaggtgtgc tcgagtctaa aatggttgca       300
     gatgcggcaa aattgggact caaggttgat tacctgctgc cacccacggc catcaacatg       360
     tcaggtgtaa agatcgactc tatccgccca gatatctttc aggatggccg tggttctgtg       420
     atggatctgc tactttgggc tgccaagaaa tataacctcg acatcgaata tgaaaaagat       480
     gaaaacctca agactcactt tatcacctcg atcgaaggca taaccggcct gccggaagtg       540
     gtagatcaag ataatctggg taaaaccgag ggccaaggct ggaagtacct tgtaggacct       600
     agtatttggg agcataagaa agagggtagc tacgaaactg aaagttacta ctacaaggag       660
     gaggagatct atttccgtat ggatcaccac ccacttaaga acgagatgag tatcgttctg       720
     gttgccgcac agcctggtga gatggatatt cgtaagaaga aataccagaa agagatggac       780
     cgtttagccg agaatggtgg caaggtgatc atccccgaga tcgtcatcga ctttaaacca       840
     gctaaaacca cggaaacagg cgaaatcctt attccgaatc aacgcgcggt atttaaagat       900
     atcgaggtca ctccccataa cctcagatcc gacatctata aagagggaac cataaccgag       960
     cttgatgcct ggctatctct ggtcgaacag cgtcccgatc tgaagatcga ttggtcctac      1020
     tggccacgtt tgagtaccaa ttcaaatgtt cagggctatg ttgcgacggc gatcagcttt      1080
     aacggccgcg atgatgtggg caatattgtt aacgaacgat atactaacaa cggctcttgc      1140
     ggattcgttc accacacggg tgagtgggaa aactacatgg actcaggagc ccaaaatggt      1200
     ctctatcaat gggtaatgtg ttcggccaga acagatatgg gcggcgatga atatcgtaaa      1260
     gcctgttatg gccagatccc cgggatcctt ggctatcgtg cccgcaacta tggtgaaggt      1320
     gagcaatttg agaaccataa ccctaagggg cgtggttata tgaagtttgg tttgcctttc      1380
     ggtggtaacg accctcacct gacgggtgat gccatgatca tctatggccc tgaatacatc      1440
     aactatattg gtgcagcatt cggaaatggt tatggtaacc aagagtcgac ttcaggttgt      1500
     gatgccgaag ctcctgagat cgatccgact cgcatcaaag atatcagcca agccagagcc      1560
     ccgttaacac cgtctcactt tggttggaaa ataccggatt gtaccacctg tcacaatgcc      1620
     gccaacagcc atgtggttca agatatggcg ccatgggaat gtgctgaatg tcatggaaat      1680
     aatggtgcac ctgacagtca tggtgagtta ctgacctgtg gtttctgtca tgccaagaca      1740
     ttagccaaac acggcgatgc ttactcaacc aaagatgatt actacagtga gcaaaccaac      1800
     tttaaagagc ctgaaagctg cttgacttgt catgtagaaa aacaggaagg cactcagtaa      1860
//

If you have problems or comments...

PBIL Back to PBIL home page