(data stored in ACNUC7421 zone)

EMBL: CP000821.PE527

CP000821.PE527       Location/Qualifiers
FT   CDS_pept        complement(644770..645162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0528"
FT                   /product="protein of unknown function DUF971"
FT                   /note="KEGG: slo:Shew_0373 protein of unknown function
FT                   DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35140"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL7"
FT                   /protein_id="ABV35140.1"
FT                   /translation="MTNPESPMVTALKLKRKSRQLEITFDTGETFQISCEMLRVYSPSA
FT                   EVHGHGNPVLVTHKKNVNIKELTPVGNYAVKITFDDGHDTGLFSWQILHGLATNQVELW
FT                   ENYLARLRAAKASREPLIDMAVKYYK"
     atgacgaatc ctgaatcacc tatggttacc gcccttaagc ttaaacgtaa atcacgccag        60
     cttgagatca ccttcgatac gggtgaaacg tttcagatca gctgtgagat gctacgtgtc       120
     tactcccctt cggcggaggt acatgggcat ggcaatccgg tattagtcac ccacaagaaa       180
     aatgtcaaca ttaaggagct gactcctgtt ggcaactatg cggtgaaaat caccttcgac       240
     gatggtcacg atacgggcct gttctcatgg cagattttac acggactcgc gacgaaccaa       300
     gtcgaactat gggaaaatta tctcgccaga ctgcgcgcag ctaaagccag ccgcgagccg       360
     ttaattgata tggcggttaa atactataaa tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page