(data stored in ACNUC7421 zone)

EMBL: CP000821.PE528

CP000821.PE528       Location/Qualifiers
FT   CDS_pept        complement(645332..647365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0529"
FT                   /product="Methyl-accepting chemotaxis protein-like protein"
FT                   /note="KEGG: ppr:PBPRB1868 hypothetical chemotaxis
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35141"
FT                   /db_xref="GOA:A8FQL8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL8"
FT                   /protein_id="ABV35141.1"
FT                   /translation="MDAILNLTVRLKLLLGFGLVIAIFIISSSIVYTQLQDINTTQSRL
FT                   LELRTPTVQAGMNLEAAITQTLSGLRGYLILGGDPSKAKLFKDERAQGWDKLEQSLMTL
FT                   EGFAKNWTVPRNIERLNEMKMIIRQFKQAQQQIEDIAHTDKNIPSFDILLTKAAPTAAR
FT                   TLTALTAIIESEMANPSDIEHKRFLKTLADSRAAFAMGLANIRAYLLSGELKFKNNYLE
FT                   LKGRSDSLMLDLESSIDLMSVEQREQWDSFKLARSEFAPYVIQMFGSRSSAEWNQANHW
FT                   LGTLAAPRARKIKSILEEMRTSQANLFKADQRSLTEASDTLNFVLLLSGVLTIIFGAVI
FT                   AVAISQSVTRPLGGEPAEMVNIANSIAEGDLTLRFTHAANAKGLYLSMYKMHAKLKELV
FT                   SNIAGAAEQLTDTAVQTSGMSEQTNNNVQDQFQQTELVATAVEEMTVTVNEVSLNASNC
FT                   LSVIQESETTIKEGQENVLQTVGNVEKLASDINDATGVILSLQEKSAEINSVSEVIGSI
FT                   AEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALASKTQESISSINSVILSLQQSADE
FT                   AATAMQSSQNSAENTISEARSSGESLSKIAESSRQIVDMASQISVASEEQASVTLDISQ
FT                   NVQMIRSGAEQTSIGASEMVKTSEQLSTQANSLKSMVASFRY"
     atggatgcca tcttgaattt gaccgtaagg ctcaaattac tactgggttt tggcttagtt        60
     atcgcaattt tcatcataag ctcgagcata gtttatacgc agctgcaaga catcaacacc       120
     acacaaagtc ggctgttaga actcaggacg cccacagtac aggccggaat gaatcttgag       180
     gccgcaataa ctcaaacttt atcaggcctg aggggctacc ttattcttgg cggcgatcca       240
     agcaaggcta agctattcaa ggacgaacga gcccagggct gggataaatt agagcaatcc       300
     ctcatgactc tggagggttt tgccaaaaat tggaccgtcc ccagaaacat agagcggctc       360
     aatgagatga aaatgattat ccgccagttt aagcaggcac agcagcagat tgaggatatc       420
     gctcatacag ataaaaacat cccctctttc gatattctcc tcactaaagc agcaccaacg       480
     gcggccagaa ccctgaccgc actaaccgct atcatagaga gtgaaatggc taatccaagt       540
     gatatcgaac ataagcgatt cctcaaaacc ttagccgaca gccgggctgc atttgccatg       600
     ggtttagcaa atattcgggc atacttactt tccggcgagc ttaagttcaa gaacaactac       660
     ttagaactaa agggcagaag cgatagctta atgctggatc tcgaaagttc aattgacttg       720
     atgtcggtag aacaaagaga acaatgggat agttttaagc tggccagaag cgagtttgcc       780
     ccctatgtaa tacagatgtt tggttctcgc tccagcgccg aatggaacca ggctaaccat       840
     tggctaggta cattagcggc acctagagcc cgtaagataa agagtatcct ggaagagatg       900
     cgaacctccc aggcaaacct atttaaagcc gatcagcgga gcctgaccga agcgagtgac       960
     acattgaact ttgtcttact cctttctggc gtgctaacga tcatattcgg tgctgttatc      1020
     gcagttgcta tcagtcaatc tgtcacccgg ccactgggtg gtgaaccggc tgaaatggtc      1080
     aacattgcca acagcatagc cgaaggagac ctgaccttac gctttaccca tgccgccaat      1140
     gcgaaaggct tgtatctgtc tatgtataag atgcacgcca agctaaaaga gttggtcagc      1200
     aacatagccg gtgctgccga acagttaacc gataccgccg ttcaaacttc ggggatgtct      1260
     gagcagacca ataacaatgt tcaagatcag ttccagcaga cagagttggt cgccaccgca      1320
     gttgaggaga tgacagtcac agtcaacgaa gttagcctca acgcctctaa ctgcctcagc      1380
     gtgatacagg aatctgaaac aaccattaaa gaggggcagg aaaatgtcct gcaaacggtt      1440
     ggtaatgttg aaaagcttgc aagcgatatc aacgacgcca caggggtaat actatctctg      1500
     caggagaaga gcgccgaaat aaactcggtc tccgaggtga taggcagcat agccgagcag      1560
     actaacctgc tggccttaaa tgccgccatc gaagctgcaa gggctggaga gcagggacga      1620
     gggtttgccg tggtcgctga tgaggtcaga gccctcgcct ccaagactca ggagtcgata      1680
     tcgagtatta actccgttat tctgtcgctc cagcaaagtg ctgatgaagc tgccacggcg      1740
     atgcagtcga gccaaaacag tgctgaaaat actatatctg aagcgaggag ctccggtgag      1800
     tcactctcaa aaatagccga gtcgagccgg cagattgtcg atatggcgag tcaaatatcc      1860
     gtagcgtcag aggagcaggc aagcgtgacc ttagatatca gtcaaaacgt acagatgatc      1920
     agaagcggag cggagcagac atcgattggt gcatccgaga tggttaagac cagtgaacag      1980
     ctgtcgaccc aggctaacag cttaaaatct atggtcgcct catttcgtta ttaa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page