(data stored in ACNUC7421 zone)

EMBL: CP000821.PE529

CP000821.PE529       Location/Qualifiers
FT   CDS_pept        complement(647610..648935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0530"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: slo:Shew_0374 heat shock protein HslVU, ATPase
FT                   subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35142"
FT                   /db_xref="GOA:A8FQL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQL9"
FT                   /protein_id="ABV35142.1"
FT                   /translation="MSEMTPREIVHELDTHIIGQHDAKRSVAIALRNRWRRMQLDVDFR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DSAIKMTREDQMKKCKFKAEEAAEERILDALLPKPKEDWDNEKPDDSATRQIFRKKLRE
FT                   GQLDDKEIEIDVAAPQVGIEIMSPPGMEEMTNQLQSMFQNMGPGDSKRRKMPIKEAYKL
FT                   MIEEEAAKLVNQDDMKEQAIELVEQHGIVFLDEIDKICKRGESSGPDVSREGVQRDLLP
FT                   LVEGCTVNTKHGMVKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELSALTADDFKR
FT                   ILTEPHASLTEQHVAMMGTEDVKIEFTEDGIESIAQAAWQVNERTENIGARRLHTVMER
FT                   LMEDLSYDASDKSGNTFVIDAEYVSSHLDDLVQDEDLSRFIL"
     atgtctgaaa tgaccccacg tgagatagtc catgagttag acactcacat tattggccaa        60
     catgatgcga aacgttcggt ggctatcgcc ctgcgtaacc gctggcgtcg tatgcaactc       120
     gatgtcgatt tccgtcagga agtgacccca aagaatatct taatgatagg tcctaccggc       180
     gtcggtaaaa cagagatcgc ccgccgcctg gctaaactgg caaaggcgcc gtttatcaag       240
     gtcgaagcca ctaagttcac cgaagtgggc tatgtcggca aagaagtgga acagatcatt       300
     cgcgatctta ccgattctgc gattaagatg acccgtgaag atcagatgaa gaagtgcaaa       360
     ttcaaagccg aagaggccgc tgaagaacgc attctcgatg cacttctacc taagcctaaa       420
     gaggattggg acaacgaaaa gcccgatgat tcggcgactc gccagatctt ccgtaagaag       480
     cttcgtgaag gtcaacttga cgacaaagag atcgaaattg acgttgctgc acctcaggtc       540
     ggcatcgaaa tcatgtctcc tccaggcatg gaagagatga caaaccagct acaaagcatg       600
     ttccagaata tggggcccgg cgacagcaag cgtcgtaaga tgccaatcaa agaagcttac       660
     aagcttatga ttgaagagga agctgcaaaa ctcgtcaatc aagatgacat gaaagagcag       720
     gctatcgaac tggttgagca gcacggtatc gtcttcttag atgagatcga taagatctgt       780
     aagcgtggtg aatcttcagg tccggatgta tcccgtgaag gtgtacagcg tgacctgctg       840
     cctttagttg aaggttgcac ggtcaacacc aaacacggca tggttaaaac cgaccatatc       900
     ctgtttatcg cctcaggtgc attccagatg tctaagccgt cagacttgat cccggaacta       960
     cagggtcgtc tgcccattcg tgtcgagctc agcgccctga ctgccgatga cttcaagcgc      1020
     atcttaaccg agcctcatgc ctcactcact gagcaacacg ttgctatgat gggcaccgaa      1080
     gatgtgaaaa ttgagttcac cgaagatggc atcgagagca tcgctcaagc tgcatggcag      1140
     gtaaacgagc gtaccgaaaa tatcggtgcc cgtcgtctgc acacagtgat ggagcgtctg      1200
     atggaagatc tatcctatga cgcgtctgac aagtccggta acaccttcgt tatcgatgct      1260
     gaatatgtca gcagccactt agatgattta gtgcaagacg aagatctaag ccgctttatt      1320
     ctataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page