(data stored in ACNUC7421 zone)

EMBL: CP000821.PE53

CP000821.PE53        Location/Qualifiers
FT   CDS_pept        complement(64688..65839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_3952 flagellar hook-length control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34666"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP93"
FT                   /protein_id="ABV34666.1"
FT                   /translation="MISNVIDLSSGIGGTKDSLTGTKIANSQQEEPGTQASYSACSASS
FT                   IAERIPEQEAAIVSDLPPVGTLNLLISPAQTQVSTTQSGQTSPGQFMISGEYQASLNPS
FT                   GVETLNRFLHLSNDQNQTAPPFVTSPPLQGGTYSASDASKTSAHNTAQVSQLQTLTGKA
FT                   NETPLSLNQTQTSSLPLPEQPGGKHPFSSQFSASLSGERNANLHLPLTLAESRLSDVNE
FT                   AAVQVLAGGHRTQAPVSQWGPVPVTSAAPLAHQAQEMLSPLREQIRFQVDQQIKQAELR
FT                   LDPPELGKVELSIRLDGDRLHIQMHAANASVRDSLLIGLERLRAELAMDHGGQIDVDIN
FT                   QGKQEQRESSPEASSISLARGDEPDNHSTKHDSQQSNQIDLLA"
     atgatatcta atgtaatcga cttaagctcg ggcataggtg gaacaaaaga ctctttgaca        60
     gggactaaga tcgccaattc gcaacaggaa gagccaggaa cacaagccag ctactcagcg       120
     tgttccgcct caagcatcgc tgaacggata cctgagcaag aagcggcgat cgtatctgac       180
     ttacccccgg ttgggacatt gaacctatta atctcacccg cacaaaccca ggtgtcaacg       240
     acccaatccg gtcagacgtc acccggtcaa ttcatgatat ccggtgaata ccaggcctca       300
     ctcaacccgt caggtgttga gacgcttaat cgattcttac atttaagtaa tgatcagaat       360
     cagactgcgc ctcccttcgt cacatcgccc cccctccagg gcggaactta ctctgcttca       420
     gatgcaagca aaacgagcgc tcataacaca gcgcaagtat cacaactgca gacactgaca       480
     ggcaaagcga atgaaacacc gctttcactg aatcagaccc aaacatcttc tctgccacta       540
     cctgagcagc cgggaggtaa acatccattt tcctcacaat ttagtgcgag cctttccggg       600
     gaaaggaatg ccaacctaca cttgccatta accctggcag agtctcgtct atccgatgtt       660
     aatgaggccg ctgttcaggt attagccggc ggccatagaa ctcaggcccc cgtgagtcaa       720
     tggggtccgg tacccgtcac ttcagcagca ccattagctc accaggccca agagatgctt       780
     tcgccattac gggagcagat ccgatttcag gtagaccaac agataaaaca agcggagctg       840
     agactggatc ctcccgaact cggcaaagtt gagctgagta ttcgattgga tggagaccga       900
     ctccacattc agatgcatgc cgcaaacgcc tccgttagag actcgctttt aattgggtta       960
     gagcgcttac gtgccgaact cgctatggat cacggcgggc agatagatgt cgacattaat      1020
     cagggcaaac aggagcagag agagtcctct cccgaagcct cctcaatctc actggcacgt      1080
     ggcgatgaac cagataatca cagtacaaaa catgacagtc aacagagtaa tcaaatcgat      1140
     ctgttagcct aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page