(data stored in ACNUC7421 zone)

EMBL: CP000821.PE531

CP000821.PE531       Location/Qualifiers
FT   CDS_pept        complement(649764..650330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0532"
FT                   /product="sporulation domain protein"
FT                   /note="KEGG: slo:Shew_0377 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35144"
FT                   /db_xref="GOA:A8FQM1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM1"
FT                   /protein_id="ABV35144.1"
FT                   /translation="MKNRDYANRKPAKGKGKTARRGKQAPAPRRFPVLLLLITVSLLGG
FT                   FGYFLWSINDSAETTSPDVVEQPKKTVVKKDPNALPPKPKEEWTYQRELENKQVEVDIP
FT                   EQTAPTRPYQMQCGSFRTQSQAEQMKAVIAFQGLSANVRKVKGTTGDWYKVSLGPYDRK
FT                   RLAEKHRHILQGAGINGCIILYWEG"
     atgaaaaatc gcgactacgc caatagaaag ccggccaaag gtaaaggtaa aacagcacga        60
     agaggcaagc aagcgcccgc acccagacgc tttcctgttc ttttattgct tattaccgtc       120
     agcctgctcg gtggatttgg atacttccta tggagcatca acgacagcgc agaaacaacg       180
     agtcctgacg tagtagaaca gcccaagaag accgtcgtga aaaaggatcc caacgcactt       240
     cctcctaagc caaaagagga atggacctat cagcgagagc tggaaaataa gcaagtcgaa       300
     gtcgatatac cggagcaaac ggcaccaact cgaccttatc agatgcagtg tggttcattc       360
     agaactcagt ctcaggctga acagatgaaa gcggttattg cctttcaagg cttatctgcc       420
     aatgtgcgta aagttaaagg cacaacaggc gattggtata aagtcagctt aggcccgtac       480
     gatcgtaagc gactggcgga gaaacatcgt catatcttgc aaggtgcagg cattaacggt       540
     tgtatcattt tatactggga aggatga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page