(data stored in ACNUC7421 zone)

EMBL: CP000821.PE533

CP000821.PE533       Location/Qualifiers
FT   CDS_pept        complement(652346..654574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0534"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: slo:Shew_0379 primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35146"
FT                   /db_xref="GOA:A8FQM3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM3"
FT                   /protein_id="ABV35146.1"
FT                   /translation="MLVSIDQSCHPMPLFVEVALPVPMRQAFSYKVPDSISTLPKKGMR
FT                   VKVPFGRQQLIGLVTGISDTCNLAPQQIKSIFELLDDEPLLPDSLYKLTAWAARYYFCS
FT                   LGQMLSQAIPVALRKGAEISSNTTTFWHLTQSGRSASLDTLKRAPAQKKVMEHLLKGEL
FT                   TQDEISSLALSKSALKALNERAWITQDERVNSIDLSWREKLELDEDPLTLNPEQAIAVA
FT                   TLNQQTGYHCTLLEGITGSGKTEVYLALLESVLSKGKQALILVPEIGLTPQTISRFKSR
FT                   FKVQVAVIHSGLTDNQRLAAWQQAKTGEAAIIIGTRSALFTPMAFPGVIILDEEHDSSF
FT                   KQQEGVGYHARDLAVMRGHLEKIPVLLGTATPSLESLQNALSGRYKHLELGQRAGNAEK
FT                   VRQGIIDISNQPLNTGLSHALLNEMRIHLDAGNQVLLFLNRRGFAPALLCHECGHLHEC
FT                   DRCDAFFTVHQSLGEIRCHHCGNHYAIPKQCHNCGSTMLMGQGVGTEQLANILEKEFPK
FT                   YPVVRIDRDTTSRKGALEAHLNAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGAL
FT                   FSADFRAPERFGQLYTQVSGRAGRARKPGTVLMQTHQADNPVLRELMHKGYGEFARGQL
FT                   NERKQALLPPAWHMLLIRAEAHQALDADNFLSQVAELLPQNEESEVIGPMPAPMDKKAG
FT                   KYRRHLIFQTKSRNQLQHAFEHALPQIESLPLAKRCRWSLDRDPQDLL"
     ttgctggtat ccattgatca atcttgtcac cctatgccct tgtttgtcga ggttgccttg        60
     cctgtgccta tgcggcaagc cttcagttat aaagtaccag attccatttc aacccttcct       120
     aaaaaaggga tgagagttaa agtacccttt ggtcgtcagc aattaatcgg tttggtcacg       180
     ggcatttccg atacctgtaa cttagcacct cagcagataa aatctatctt tgagctgtta       240
     gatgatgaac cactactacc tgattcactt tataaactaa ccgcttgggc tgcaagatat       300
     tacttttgta gcttaggtca aatgctctcg caagccatcc cggtcgcttt gcgtaaggga       360
     gcagagatct catcaaacac caccactttc tggcatctga cccagtctgg cagatctgca       420
     tcactcgata ccttgaagcg cgctcccgca cagaaaaaag tcatggagca cctgctcaag       480
     ggcgagctaa ctcaagatga aatatccagc ttagccctga gtaagtcggc gttaaaagcc       540
     cttaatgaga gagcgtggat aacccaggat gaacgggtca actctatcga tctttcctgg       600
     cgagagaaac tcgagctcga tgaagacccc ttaacgctaa atccggaaca agccattgca       660
     gtggccacgc tcaaccaaca aaccggttat cactgcactt tactcgaagg tattacaggt       720
     tcgggtaaga cagaggtcta cctggccctg ctggagtcgg ttctcagcaa ggggaaacag       780
     gcactgatct tagtacccga gataggctta acgccacaaa cgatcagccg cttcaagagc       840
     cgattcaagg tgcaggtcgc cgttattcat tcaggactaa ccgataatca aagattagcg       900
     gcatggcaac aggcaaaaac cggcgaggcg gcgatcatta tcggcacacg ctcggccctg       960
     tttacgccta tggcttttcc gggagtgata atcctggatg aagagcatga ctccagcttc      1020
     aagcaacagg agggcgtcgg ttaccatgcc cgggatctcg cagtgatgcg gggtcattta      1080
     gaaaaaatcc ctgtgctact cggtacggcg accccctccc tcgaaagcct gcaaaatgca      1140
     ctcagcggcc gttacaaaca cttagagctg gggcaaagag caggtaatgc tgagaaagtg      1200
     cgccagggca tcatagatat cagcaatcag cccctgaata ccgggctttc ccatgcgctg      1260
     ctgaacgaga tgcgtattca tctcgacgcg ggtaaccagg tactcctgtt tctgaaccga      1320
     agaggcttcg ctccggcact actctgtcac gagtgtggtc acctccatga gtgtgaccga      1380
     tgtgatgctt ttttcactgt acatcagtca ctgggcgaga tccgttgcca tcactgcggt      1440
     aatcattacg ccattccaaa acagtgccat aactgtggca gtaccatgtt gatgggacaa      1500
     ggcgttggca cagagcaact ggctaatatt ctggagaaag agttcccgaa atatcctgtg      1560
     gttcgaatcg atcgcgatac cacaagtaga aagggcgccc tcgaagcaca tctcaacgct      1620
     atccataaag gcgagtataa gatcctggtc ggcacgcaaa tgctggcaaa agggcatcac      1680
     ttccccgatg tgactctggt cggtttatta gatgtcgatg gcgccctgtt cagtgccgac      1740
     ttcagggcac ccgaacgatt cggccaactt tatacccagg tatcgggccg tgcgggaaga      1800
     gccagaaaac cgggtaccgt gctgatgcaa actcatcaag ccgataaccc tgtattacgg      1860
     gaactaatgc ataaaggcta tggcgaattt gcccgtggtc aactcaatga acgtaagcaa      1920
     gccttgctgc caccggcctg gcatatgctg cttatccgcg ccgaggcaca tcaggcctta      1980
     gatgccgata actttttatc ccaagtcgcc gaactcttac cgcagaacga ggagagtgaa      2040
     gtcattggtc ctatgcccgc tcctatggat aaaaaagcgg gtaaataccg ccgacatctt      2100
     atttttcaga ccaagtcgcg caatcaatta cagcatgcat tcgaacatgc cttgccacag      2160
     atagagtctc tgcctttggc gaaacgctgt cgatggagct tagatagaga cccacaagat      2220
     ctgctctaa                                                              2229
//

If you have problems or comments...

PBIL Back to PBIL home page