(data stored in ACNUC7421 zone)

EMBL: CP000821.PE534

CP000821.PE534       Location/Qualifiers
FT   CDS_pept        654629..655435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35147"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM4"
FT                   /protein_id="ABV35147.1"
FT                   /translation="MARIIQIALFSFFLISVQFLGASYANAQMTHVSINQQLFGLGDYP
FT                   KLRVNIVSGHENLDKVQFIVRQTSGDERLMVKPINNFMLLLTGVDDVVDPSAQLIVKEY
FT                   RVNQWHLIKTLALFTDEQIAKGFSAKTQPKPKPKAKQKQVKQKVEVESGVAVSTKSTQN
FT                   SKPASAALLAAQTSNTSTVAELTQDNCVLEYDGNQTLWRIGTQYSQEWEMGTYGAMLAI
FT                   FEANPKAFNKGEISGLRADVALLCPSVPLKEKYRDNQMAKRIYEKL"
     atggcaagaa taattcaaat cgcactgttt tcatttttct tgataagcgt ccagttcctg        60
     ggtgctagct atgctaacgc tcaaatgacc catgtgagta ttaatcagca actgttcggt       120
     ttaggtgact accctaagtt aagggtaaac attgtctccg ggcatgaaaa cctggataag       180
     gtgcagttta ttgttcgcca aaccagcggc gatgagcgtt taatggttaa accaatcaat       240
     aactttatgt tgcttctgac gggagtcgac gatgtggtcg atccctcagc gcagttaatc       300
     gtcaaggagt accgggttaa tcagtggcac ctgattaaaa ccttagccct gttcactgat       360
     gagcaaattg caaagggatt tagtgctaaa actcaaccta agcctaagcc taaggcaaag       420
     cagaagcagg ttaagcaaaa agtcgaagtt gagtcaggtg ttgccgttag tactaaaagt       480
     actcaaaatt cgaaaccggc ctcggccgcc ttgctcgcag cgcagacaag caacacctct       540
     actgtcgcgg agttgacgca agataattgc gtactcgagt acgatggcaa tcagactctg       600
     tggcgaattg gcactcaata tagtcaagag tgggagatgg ggacttatgg tgccatgctt       660
     gctatcttcg aggccaaccc taaggccttc aataagggcg aaattagtgg cctgagagcc       720
     gatgtcgcat tgctctgtcc atctgtgccg ctcaaagaaa aatacagaga taatcagatg       780
     gcaaaaagaa tctacgaaaa gttatag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page