(data stored in ACNUC7421 zone)

EMBL: CP000821.PE536

CP000821.PE536       Location/Qualifiers
FT   CDS_pept        656060..656920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0537"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="KEGG: slo:Shew_0382 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35149"
FT                   /db_xref="GOA:A8FQM6"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM6"
FT                   /protein_id="ABV35149.1"
FT                   /translation="MNTFQLPSSSMLLTNLFFLTLALTILPTTQAAQAKITQQEGQVLN
FT                   DGVTSALCAPTHYDEQVELKYVNDGDTITLKDGRLVRLIGVDSPELDFKSPELSEPYAK
FT                   EARHFLQKELKPGQILNLSFDQKRLDPYGRTLAYVYTENGEHLQELLLSQGFAKTRVYQ
FT                   NDYFWQCLNQVELTARDKELGLWSHPDYRAKTVDELGRSDRNRWGEVKGVVTGYERKGQ
FT                   YLWLILDEKFYVGIPRAESGKFSNILNLNLLESPVIVRGSLYYSYKKWQLISSHPSQIS
FT                   LQNRP"
     atgaatacat ttcaattgcc gtcttcctca atgctactga ctaatctttt ttttctgacc        60
     cttgccctca ctattctacc gacgactcaa gctgcgcaag caaagataac tcaacaagag       120
     ggccaagtgc taaatgacgg ggtgacgtcc gccttatgtg ctcccacgca ttatgatgag       180
     caggttgagc ttaaatacgt taatgatggc gataccatca ccctgaaaga tgggcgtctg       240
     gtacggctga ttggtgtcga ttcgccggag ctcgatttta aatcacctga actgtcagaa       300
     ccatacgcaa aagaagcgcg acatttttta cagaaagagc tcaaacctgg tcagatatta       360
     aacttgtcct tcgatcaaaa gaggctggat ccctatggtc gtactttggc ctatgtttat       420
     actgaaaacg gcgagcatct tcaggagctt ctattaagcc aaggtttcgc taagactcgt       480
     gtttatcaga atgattattt ttggcagtgt ttaaaccaag tcgagttaac tgccagagat       540
     aaggaactgg ggttatggtc acatccagac tatcgcgcca aaacggttga cgagttaggc       600
     aggagcgacc gtaatcgatg gggtgaggtc aaaggggtcg ttaccggata tgaaagaaaa       660
     ggccagtatt tgtggctcat tttagatgaa aagttctatg ttggtatacc tagagccgaa       720
     tctggtaaat ttagcaacat tttgaacctt aacctgcttg aaagcccagt aattgtccgt       780
     ggttcgttgt attattccta caaaaagtgg cagttgatca gtagtcatcc ctcgcagata       840
     agtttgcaaa atagacctta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page