(data stored in ACNUC7421 zone)

EMBL: CP000821.PE539

CP000821.PE539       Location/Qualifiers
FT   CDS_pept        660903..661817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0540"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: sbl:Sbal_3839 conserved hypothetical
FT                   biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35152"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM9"
FT                   /protein_id="ABV35152.1"
FT                   /translation="MGKSLFSRLAFWQKSNSKIKIGIYVCPDKLIVYRAIDDSENSDEL
FT                   KATYEFVFDGTDWSGVFALIAKQFAPAQIQITLCSAFYQLLLVDKPNVESEEMTQALLW
FT                   SVKDMVSQPVTDIHLDYFEPPLPGHTKLNVVVVEKASLSALVLAAKDHDMEVVGINIEE
FT                   MAVTNLFTEEAQARLVLSHTSGQELLLTVVRQGELFMQRRVRGFNQLDSVSAEDLAFGL
FT                   ADNLSLELQRSMDYFESQLRQAPVASIELLINGHVGKLAELVSANFNQKVNAIEVDSVE
FT                   AKMAALALDEFNRDESAERGMNS"
     atgggaaaga gtctttttag caggttggct ttctggcaga aatctaattc aaaaatcaaa        60
     ataggcatct atgtctgccc tgataagctt attgtttatc gggccattga tgattccgaa       120
     aattcggatg agcttaaagc tacctatgag tttgtgttcg atggcaccga ttggtcaggg       180
     gtctttgcac tgatagcaaa gcaatttgcg cctgcccaga ttcagataac cttgtgctcc       240
     gctttttatc agctcctgct agtcgataag cccaatgtcg aatctgaaga gatgacgcag       300
     gccttgctct ggtctgttaa agatatggta agccagcctg tcaccgatat tcacctggat       360
     tacttcgagc ctccattacc gggtcatacc aaattaaatg ttgtggttgt cgaaaaggcc       420
     agcttgagtg ccttagtgtt agccgcgaaa gatcacgata tggaagtcgt gggaattaat       480
     attgaagaga tggctgtgac taacctattc accgaagagg ctcaggcgcg actggtattg       540
     agtcatacct ccggtcagga gttgctgttg actgtcgtca ggcagggtga gttatttatg       600
     cagcgacgtg tgaggggatt taatcagctc gatagtgtga gtgctgaaga tcttgcattt       660
     ggcctggccg ataacctaag cctggaacta cagagatcca tggattattt tgagagccaa       720
     ttgcgtcagg ctcccgtggc atcgatcgag ctattgatta atggtcatgt cggaaagctt       780
     gccgagctgg ttagcgctaa ctttaaccaa aaggttaatg cgattgaagt tgactctgtt       840
     gaggctaaga tggctgctct ggccttggat gagtttaatc gagatgagtc ggcagaacga       900
     ggtatgaatt catga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page