(data stored in ACNUC7421 zone)

EMBL: CP000821.PE54

CP000821.PE54        Location/Qualifiers
FT   CDS_pept        complement(65829..66155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34667"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP94"
FT                   /protein_id="ABV34667.1"
FT                   /translation="MSEKAGPTSIELWKRFETALQEYANAEDWDKVVKVNALMVLALKK
FT                   AGKPATKSQLVARKALATTHANILQNLHQKKDKLQQDIHQFKGQQDGLAAYQLTRLSGE
FT                   INDI"
     atgtcagaga aggctgggcc aacctcaatt gaactgtgga agcgatttga aacggcgctg        60
     caagagtatg cgaacgctga ggattgggac aaggtggtaa aggtgaatgc attgatggtt       120
     ctggcactaa aaaaagcagg taaaccggcg acgaaatcac aactcgtcgc ccgtaaagct       180
     ctggcaacga cccacgcaaa catactgcag aatctgcatc agaaaaaaga caagttgcag       240
     caggatatcc accaatttaa ggggcaacaa gatggccttg ccgcttatca actcacccgc       300
     ttaagcggag aaattaatga tatctaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page