(data stored in ACNUC7421 zone)

EMBL: CP000821.PE540

CP000821.PE540       Location/Qualifiers
FT   CDS_pept        661814..662425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0541"
FT                   /product="fimbrial assembly family protein"
FT                   /note="KEGG: slo:Shew_0386 fimbrial assembly family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN0"
FT                   /protein_id="ABV35153.1"
FT                   /translation="MTMKTRVNLFSASLLPPELRLSFNHLTLVLLVLVGLFTIAIGGSY
FT                   ALVSALETDKAELNKQKRNLDNQKQDLETALANRAPDSALVDEVDLLSQQVELKRMLLG
FT                   ELSQREALTSHGYSPLMKDLARVANSNIWLSRIQVDNNSFIFEGFSSAPHSVPLWVDRL
FT                   KLTDTLKGHAFASMTMSRGEGKPLAFTLTSKAGDSVENNQ"
     atgacgatga agaccagggt taacctcttt tctgcttcac ttttgccacc ggagctgagg        60
     ttatcattca atcaccttac tctggtgttg ttggttttgg ttggcctgtt caccatagcc       120
     ataggcggaa gttatgcgtt agtctcggct ctggaaaccg acaaagcaga gttgaataag       180
     caaaagcgta acctggacaa tcagaagcaa gatcttgaga ctgcgctggc caatcgggca       240
     ccggattcgg cccttgtcga tgaagtcgat cttctgtctc aacaggtgga gctgaaacgt       300
     atgctactcg gagagttgag tcaaagagaa gcattgacca gtcatggtta ttcgcctctg       360
     atgaaagatc tcgctcgcgt tgccaatagc aatatttggc tcagcagaat ccaggtcgat       420
     aataatagct ttattttcga aggttttagc tccgcgcctc acagcgtacc actttgggtc       480
     gatcgcctga aattaactga cacgctcaag gggcatgcat ttgcttcgat gacgatgagt       540
     cgtggagagg gcaagccatt agcatttacc ctgaccagca aagcgggcga tagtgtggag       600
     aataatcaat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page