(data stored in ACNUC7421 zone)

EMBL: CP000821.PE541

CP000821.PE541       Location/Qualifiers
FT   CDS_pept        662422..663072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0542"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: slo:Shew_0387 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35154"
FT                   /db_xref="GOA:A8FQN1"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN1"
FT                   /protein_id="ABV35154.1"
FT                   /translation="MKQRWQALGERFDLLSQRERVMVATAAVVVIGMLCYLPLESLLLK
FT                   YNALSKQITAITAENKISLQQIELYEQRLAQDPNDEYNNRLQVLKQQSADLDDQLSFQM
FT                   VDMIPADHMPTLLSQLLGKVTGIKLQEFKSIAPTPLLALDDEKKTNLYSHGIRLTLEGD
FT                   YFSLLKFIEAVESMPNKLYWKQMDYKVEEYPGANVVLELYTISVNKDFISVAN"
     atgaagcaga gatggcaagc attaggtgag cgcttcgatc tgttgagtca acgtgaaagg        60
     gtgatggtag caacggctgc tgtcgtcgta atcggtatgc tttgctacct gccgctcgag       120
     tctctattac tgaaatataa cgccctctct aaacagataa cggcgatcac tgccgaaaat       180
     aaaatatcgc tgcaacagat cgagctatat gagcaacgct tagctcaaga tcccaatgat       240
     gagtacaata accgccttca ggttctcaag cagcagagtg cagatctcga cgatcagctg       300
     tcatttcaga tggtcgatat gatccctgcg gatcatatgc ctaccctgtt gagtcagttg       360
     ttaggcaagg taactggtat aaagttgcag gagtttaagt ctattgcacc gactccgctc       420
     ctggctctcg atgatgagaa gaaaacgaat ctatatagcc atggtatccg cctcacatta       480
     gagggggatt atttctcatt gctaaagttt atcgaagccg ttgaaagtat gcccaataag       540
     ctctactgga aacagatgga ttacaaggtt gaagagtatc ctggcgctaa tgtcgttttg       600
     gaactttaca ccataagtgt caataaggac ttcatcagtg ttgcaaatta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page