(data stored in ACNUC7421 zone)

EMBL: CP000821.PE542

CP000821.PE542       Location/Qualifiers
FT   CDS_pept        663059..663409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0543"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: she:Shewmr4_3487 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35155"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN2"
FT                   /protein_id="ABV35155.1"
FT                   /translation="MLQIKASSLFSVFVSLLVLVTSTLHAETLRDPTRPGRGAVITDAR
FT                   ASGHANALVLNSVLKGETSSHAVINNKIFVLGDRVQGVKIVRIDSSSVSLADGRKLKMY
FT                   QAITETKGNKFK"
     gtgttgcaaa ttaaggcgag ctcactcttt tcagtattcg tgtcactgct ggtgctagtg        60
     acgagcactc tccatgctga aacattacgt gacccgacac ggccgggcag aggcgctgtt       120
     atcacagatg ccagagcgtc tggccatgcc aacgctttgg tactcaatag cgtattgaag       180
     ggtgaaacct catcccacgc tgtgatcaac aataagatct ttgtcttagg tgatagggtg       240
     cagggtgtga aaatagttag aatagactca agttcggtgt ccttggccga tggacgtaaa       300
     ttgaaaatgt accaagcaat aacagagaca aagggaaata aattcaaatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page