(data stored in ACNUC7421 zone)

EMBL: CP000821.PE543

CP000821.PE543       Location/Qualifiers
FT   CDS_pept        663406..665109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0544"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="KEGG: slo:Shew_0389 pilus (MSHA type) biogenesis
FT                   protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35156"
FT                   /db_xref="GOA:A8FQN3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN3"
FT                   /protein_id="ABV35156.1"
FT                   /translation="MRAINIITPLIALLLAACQTTDRPQPIESKQVLSDSVQAEQNRTT
FT                   TPPPAVMPDAIQKELASKELLSGLSPVLRTERRFDVSANDVDAKVFFPSLVQGSPLSVA
FT                   VHPGVSGTISLSLKGVTLSEALQVVEDIYGYEVSREGRILRIFPSGMRTETFPLNYLYM
FT                   ERQGLSLTSVNSGRISDSNDSNSSGSNNSNNSSNNSNSNSSNNNSDSNGNNSSNDTTNG
FT                   TFIRSTTKTDFWGELEKTLVSIVGSTGGGRQVVVTPQAGLVTVRGYPNELRQVRTFLQT
FT                   AETHLQRQVILEAKILEVTLSDGYQQGIQWDNVLGHVGSTDITFGTSENTEGLGDLITN
FT                   AIGGVTSLSVKGSNFNTMINLLDTQGDVDVLSSPRVTASNNQKAVIKVGTDEYFVTDVS
FT                   STTVAGTTPVTTPEVELTPFFSGIALDVTPQIDGEGNILLHIHPSVIDIKEQTKVIKIS
FT                   GSSLELPLAQSDIRESDTVIKAKTGDVVVIGGLMKSENIEVESKVPLLGDIPLVGELFT
FT                   NRSKSLKKTELVILLKPTVVGADTWRKELQKSKALLDRWYPEEDENGQGQ"
     atgagagcga ttaacattat tacgcctctg atagcgcttt tgttggcagc ctgccaaaca        60
     acggacaggc cacagccgat agaatcgaag caagttttgt ctgattcggt acaagctgag       120
     cagaacagaa ccacgacacc acctcctgct gttatgcccg atgcgattca aaaagagttg       180
     gcatcgaaag agctactcag tggtttgtct ccggtattga gaaccgaacg tcgtttcgat       240
     gtatcggcta atgatgtcga tgcaaaggtc tttttcccaa gtctggtgca aggttctccc       300
     ttgagtgttg ccgttcaccc gggcgtgtcc gggacgattt cactctcgtt gaagggggtc       360
     acgctcagtg aggcgcttca ggtagtggaa gatatctatg gctacgaagt cagccgcgaa       420
     ggccgaattt tacgcatttt cccatcgggc atgcgcaccg aaacatttcc gctaaactac       480
     ctgtatatgg agcgtcaggg actgtcgttg acctcggtca actcgggtcg tatatccgat       540
     agtaacgact caaattcgag tggcagcaac aatagcaata acagtagcaa taacagcaac       600
     agtaactcct cgaataataa ctccgactcg aatggcaata atagtagtaa tgatacgacc       660
     aacggcacat tcattcgctc tacgacaaag accgacttct ggggagagtt agagaaaact       720
     ctggtctcta ttgtgggcag cactggtggc ggacgtcagg tggtggtaac gccgcaagct       780
     ggcttagtga cggttcgtgg ttatcctaac gaattaagac aggtgcgtac cttcctacaa       840
     acggctgaaa ctcatcttca gcgtcaggtc atcctggaag cgaagatttt agaggtgacg       900
     ctttctgatg gttatcaaca agggatccaa tgggataacg ttctcggtca tgtggggagt       960
     accgatatca ccttcggcac aagcgagaac actgaagggc tgggcgattt aatcaccaat      1020
     gccatcggcg gtgtgacctc attaagcgtt aagggttcaa acttcaatac tatgatcaac      1080
     ctgctcgata ctcagggcga tgtcgatgta ctttcgagcc ccagggtaac ggcttcaaat      1140
     aaccaaaaag cggtgataaa agtcggtaca gatgaatact tcgtgactga tgtgtcatcg      1200
     acgaccgttg ccggtaccac tccggtgacg acacctgagg ttgaattaac accatttttc      1260
     tctggcattg cactggatgt gaccccacaa attgatggtg aaggtaatat cttattgcat      1320
     atccacccct cggttatcga tatcaaagag cagacgaagg tgattaaaat atcgggcagt      1380
     tctcttgagc tacctttggc tcagagtgat attcgtgaat ctgacactgt gattaaagcc      1440
     aaaaccggtg atgtggtggt tatcggcggt ctgatgaaga gcgagaacat agaggttgaa      1500
     tctaaggtgc cactccttgg tgatattcct ctggttggcg aactgttcac caataggtca      1560
     aaatcactta agaaaacgga acttgtgatc ttacttaagc caaccgttgt cggcgccgat      1620
     acctggagaa aagagttaca aaaatccaag gcactattgg atcgttggta tccggaagaa      1680
     gatgaaaacg gacaagggca gtaa                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page