(data stored in ACNUC7421 zone)

EMBL: CP000821.PE544

CP000821.PE544       Location/Qualifiers
FT   CDS_pept        665113..666021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0545"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: sbl:Sbal_3834 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35157"
FT                   /db_xref="GOA:A8FQN4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN4"
FT                   /protein_id="ABV35157.1"
FT                   /translation="MYLQHFGLAETPFSLTPNTEFFFGLAPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLINELPKRFHCAYLPNPYLSPAELRWAVALELGLKYSADIDQ
FT                   MQLTGLIQQQLLALCAHGHSIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFA
FT                   QPELDQRLSLHNFRQLRQRITFSYCLRALTLDEAEAYVQHRLSVAGRVGKPLFSHRDTR
FT                   LLAKASKGIPRLINILAHKALLLSFGEGSHQIEYRHVKAAIVDTEDTKLGFQTNWLWFM
FT                   GFGMMSMLAGAGLHLFYGGVS"
     ttgtatctgc aacacttcgg gctggcggaa accccgtttt cgctgacgcc caataccgaa        60
     tttttcttcg gattagcgcc tcatgttgag gcgttacagg ttcttcaaac tgcactgcaa       120
     accggtgaag gcttcattaa agttaccggt gaggtgggga cgggtaaaac cctcatctgt       180
     cgaaaattaa tcaatgaact tcccaaacga tttcattgtg cctatctgcc caacccctat       240
     ctctctcctg cagaactcag atgggcagta gccctcgaat tggggcttaa atattctgcc       300
     gatatcgacc agatgcaact taccgggctg atacagcaac agttattggc tctgtgtgcc       360
     catggtcact ccatcgtatt agtgctcgat gaagcgcaag ccctgcccga tgagagtctc       420
     gaggcattgc gcctctttac caacttagag accgagagcc gcaagctatt gcaggtggtg       480
     ctgtttgccc agcctgagtt agatcagagg ctgagcttgc acaacttccg acaactaaga       540
     caaagaatta cgtttagtta ctgcctgaga gccttgacct tagatgaagc cgaagcctat       600
     gtgcagcacc gcctgtcggt tgccggaaga gtgggtaagc ccttgttttc ccatagggac       660
     acacgcctgc tggctaaggc atctaaaggg atcccaagat tgattaatat tttggctcat       720
     aaagcactat tgctcagctt cggagagggg tcacaccaga tcgaatatcg acacgtgaag       780
     gctgcaattg tagatacaga ggatacgaaa ctgggttttc aaactaactg gttatggttc       840
     atgggatttg gcatgatgtc aatgttagcg ggtgctggcc ttcatctgtt ttatggaggc       900
     gtatcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page