(data stored in ACNUC7421 zone)

EMBL: CP000821.PE545

CP000821.PE545       Location/Qualifiers
FT   CDS_pept        666018..667259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0546"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0391 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN5"
FT                   /protein_id="ABV35158.1"
FT                   /translation="MSVINTMLKDLDKRQQSHELENLHVAPVQYQSSTPSKLPWMLLGL
FT                   VSLVLVSGIVFSWDRLTAKVSDDEAVLSVDSKSTENKAVDIKLAENMATENKAGALDEP
FT                   GLTSVAAPSIGADNRVAPEGKPDAGVTVKSEQRLTQLPAIPEQKRSSESGVKAAAKPII
FT                   KEQQVAAEEALPVITSKKQRTTSTPVSQSVKAEAPVVRSSNNGSMAVTEVKLSDDQLAQ
FT                   KRLMLASEAEQQGGQNDAIVYYNEALTLNPKLHQARKQLAALYYGKGRLDLATDLLRQG
FT                   ISLFPAEFDYVLLLARVQLASGNKAQALSTLSQIPDSSLLARQKWVEQSSLAQEVSDFV
FT                   LAEQGYRNLLGVEANQARWWMGLAYSLDAQAKYSAAKDAYKQAVLYKSVPGKGLSAQAF
FT                   DYIENRLTQLGEIE"
     atgagcgtga tcaataccat gcttaaagat ctggataagc gccaacagtc tcacgaactg        60
     gagaatttac atgtggcgcc ggtgcaatat caaagctcca cgccttcaaa gcttccctgg       120
     atgttattgg gcctcgtctc ccttgtctta gtgtcaggta tcgttttcag ttgggatcga       180
     ttaaccgcta aggtgtctga cgatgaagcg gtactctcag tcgatagcaa gtctactgaa       240
     aacaaggccg ttgatatcaa gcttgctgaa aacatggcaa ctgagaataa ggccggtgca       300
     ctagatgagc cagggcttac atcggtggct gcaccttcga ttggtgccga taatcgggtg       360
     gcccctgagg gtaagccaga tgctggtgtt actgttaaaa gtgagcagcg actaacccaa       420
     ttgcctgcca ttcccgagca aaaacgctcg tctgagagtg gagtaaaagc tgctgccaaa       480
     ccaatcatca aagagcaaca agtggcggcc gaagaagcgc tcccggtcat aaccagtaaa       540
     aaacaaagga cgacttcgac gcctgtatct cagtctgtta aagccgaagc ccccgtggtt       600
     cgatcaagca ataatggttc aatggccgtg actgaggtga agctgtctga tgatcagtta       660
     gcgcagaaga gactcatgtt ggcgagcgag gcggagcagc agggagggca aaatgatgcc       720
     attgtttatt acaatgaagc tctcacactc aaccccaaac tacatcaggc aagaaagcag       780
     cttgccgcgc tatattatgg caaaggtcgg ctggatcttg ccaccgatct cttgaggcaa       840
     gggatcagcc tgtttcctgc agagtttgac tatgttttgc tactcgctcg cgttcagctg       900
     gcatcgggta acaaggcgca agccttatcc acccttagtc agatccccga tagcagcttg       960
     ttggcaagac agaagtgggt cgagcagagt agtctggcac aagaggtcag tgattttgta      1020
     ttagccgagc agggttatcg caacttactc ggtgtggagg ccaatcaggc cagatggtgg      1080
     atgggattag cctattcact ggatgcacag gcaaagtata gcgccgctaa ggatgcctac      1140
     aagcaggctg tcttatacaa atcggtgcct gggaagggct tgtcggctca ggcatttgac      1200
     tatattgaaa acagattgac gcagttagga gagattgagt ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page