(data stored in ACNUC7421 zone)

EMBL: CP000821.PE546

CP000821.PE546       Location/Qualifiers
FT   CDS_pept        667256..669010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0547"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: shm:Shewmr7_0469 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35159"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN6"
FT                   /protein_id="ABV35159.1"
FT                   /translation="MKPKLKMRLGDLLVQEQIISEPQLMEALTEQRSTGKKLGRTLIDL
FT                   NSISEEQLLRFLSQQLHIPFIDISKRPIPPEVVNLLPEVQARRFRALVVEDNGDSALVA
FT                   MSDPADLQAMDNLEVLLTPKRLEIAVVTEGQLLDAFDNIYRRTDEIAQIAGKLEEEYAA
FT                   DDQFDLASLTDSDSDNETTVVRLLQSIFEDAVQMRASDIHIEPGDKVLRIRQRIDGQLH
FT                   ENILPEASIAAALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHQIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPEILERVRKQIKRPHGMLLVTGPTGSGKTTTLYGVLSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCQ
FT                   NCAREYELTAQDKAWLNSTSQQDFSQAKFRIGSGCQSCNGSGYRGRIGIFEILELDEAM
FT                   IDAMRTGNPQDFARAAYLSPNFIPLAVSAFKYLAEGMTTIEEVAKLVEDVNETESPLSI
FT                   RQQQGTEF"
     gtgaaaccaa agttaaagat gcgtctgggt gatctcctcg ttcaagagca gatcatcagc        60
     gagcctcagt taatggaggc tttgaccgag cagcgaagta ccggcaagaa gctgggacgc       120
     accctgatcg atctcaacag tatctccgaa gagcagctac tcaggtttct gtctcaacag       180
     ctgcacatcc cttttatcga tatcagtaag cgacctattc ctccggaggt tgttaacctg       240
     ttacccgagg ttcaggcgcg tcgtttccgt gcgcttgtcg tagaagataa cggcgatagt       300
     gccttggtgg ccatgagcga tcccgctgat cttcaggcga tggataatct cgaagtactg       360
     ctcaccccta aaagattaga gatcgcggtt gttaccgagg ggcagctgct cgatgccttc       420
     gataatatct atcgccgaac tgatgaaatt gctcaaattg ccggaaagct cgaagaggaa       480
     tatgccgccg acgatcaatt cgatctcgcg agcttaaccg acagcgacag cgataacgag       540
     accacagttg ttagattgct gcagtcgata ttcgaagatg cggtgcagat gcgagcgtcc       600
     gatattcata tcgaacccgg tgacaaggtg ctgcgcatca gacagcgtat cgatggccaa       660
     ctgcatgaaa atatcctgcc ggaggcgagt atcgccgcgg ccttagtgtt aaggctaaag       720
     ttgatggcag gtctggatat ctctgagaag cgtttgccgc aggatggccg gtttcatatg       780
     gagattaaag gccatcagat agatgttcgt atgtcgacta tgcctattta ccacggtgag       840
     tcggtggtga tgcgtctgct ggatcaatcc gcgggcctgt tgaccctgaa cgaaactggt       900
     atgccacccg agatcctgga aagggtgcgc aagcagatta aacgtcccca tggcatgttg       960
     ctggtaaccg ggccaacggg tagcggtaaa accaccacct tgtatggtgt gttgagtgag      1020
     ctcaacaccg cagatcgtaa aattatcacg gtcgaagacc cggtggaata tcaacttccc      1080
     agaattaacc aggtacaagt taaccataag attggcttag acttctctaa cgtactgaga      1140
     acgaccttgc gtcaggatcc ggatatcatc atggtcggtg agatgcgtga ccaagagacc      1200
     gtagagatcg gactcagagg cgccttgacg ggccacttcg tactgtcgac cctgcacacc      1260
     aatgatgcgg tgaccagtgc gttacgtctg ctggatatgg gggcggcgag ttatctggtt      1320
     gccagtgcgt tgagggtgat tattgcccag cgtctggtga ggcgagtatg tcaaaactgt      1380
     gccagagagt atgaactgac ggctcaggat aaggcctggc tcaacagtac cagtcagcaa      1440
     gatttttctc aggctaaatt cagaattgga tcgggctgtc aaagttgtaa cggcagtggt      1500
     taccggggac gaataggcat atttgagata ctcgagctcg atgaggcgat gatcgatgcc      1560
     atgcgtacag gcaatcccca ggattttgcc cgagcagcat acttaagccc taactttatt      1620
     ccgttggccg tgtcagcttt taagtattta gccgagggta tgactaccat agaagaggtg      1680
     gctaaactgg tagaggatgt caatgagacc gagtctcctc tgtctataag gcagcaacaa      1740
     ggaactgagt tttaa                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page