(data stored in ACNUC7421 zone)

EMBL: CP000821.PE547

CP000821.PE547       Location/Qualifiers
FT   CDS_pept        669099..670319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0548"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: shn:Shewana3_3659 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35160"
FT                   /db_xref="GOA:A8FQN7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN7"
FT                   /protein_id="ABV35160.1"
FT                   /translation="MATYKYRGRDAQGQQVTGLVDAASESAAADQLMSRAVIPLELDEA
FT                   KEKREFSLASLFKGKVSLDELQIFSRQMYSLTRSGIPILRAIAGLSETTHSQRMRDALN
FT                   DISEQLTSGRPLSSAMNHHPDVFDALFVSMVHVGENTGKLEDAFIQLAGYIEREQETRR
FT                   RIKAAMRYPIFVLIAIALAMVILNIMVIPKFAEMFSRFGADLPWATKVLIGTSNLFVNY
FT                   WPAMLVGLVATFIGIRYWHSTEKGEKQWDSWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDRIVGMRRGIESGDSMLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGFVAGIVLILALGIYLPMWDML
FT                   NVVKGGS"
     atggcgacct ataaatatcg tgggcgggat gcacagggac agcaggtgac cggattggtc        60
     gatgcggcct cagaaagtgc ggccgccgat cagttgatgt ctcgcgctgt gatcccatta       120
     gaactcgatg aggccaagga gaagcgagag ttttctctgg cttctctgtt taagggcaaa       180
     gtgtcactcg atgagctgca gatcttctcc aggcagatgt attccctgac tcgttcgggg       240
     atcccaatcc tcagagcgat cgcaggtctt tcagaaacga cacattcaca acgaatgcgg       300
     gatgcgctta acgatatctc tgaacagctc acctcgggac gtccactttc atcggcgatg       360
     aatcatcacc ccgatgtgtt cgatgcgctt tttgtctcta tggtccatgt cggagagaat       420
     accggtaagc tggaagatgc ctttattcaa ctcgcgggtt atatcgagcg tgagcaggag       480
     acccgccgac ggatcaaggc ggcgatgcga tatcccatct tcgtactcat tgccatagct       540
     ctggccatgg tgatcctcaa tatcatggtg atccccaaat ttgccgaaat gttctcccgt       600
     ttcggcgccg atcttccctg ggcgaccaag gtacttatcg gaacctctaa cctgtttgtt       660
     aactattggc ccgccatgct tgttggtctc gtcgctacct ttatcggtat ccgatactgg       720
     cacagcacag agaaggggga gaaacagtgg gacagttgga aactgcatat tccggctgtc       780
     ggtagcatca tcgagcgctc gaccctgtca cgctattgca gaagcttctc catgatgctg       840
     agcgctggcg tgcccatgac ccaggcactc agtttggtcg ccgatgcggt cgataatgcc       900
     tatatgcatg accgaatagt gggcatgcgt cgtggtatcg agtccggcga ctctatgttg       960
     agggtctcta atcagagtca attgttcacg ccactggtac tacagatggt tgccgtaggc      1020
     gaagagacgg ggcagataga tcagctgctc aacgatgccg ccgacttcta tgaaggggag      1080
     gtcgattacg acctgaaaaa cctcaccgcc aagctggaac ctatcttaat cggatttgtg      1140
     gcagggatcg tgcttatatt agcattgggt atttatttgc ctatgtggga catgctcaac      1200
     gttgtcaaag gcggcagcta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page