(data stored in ACNUC7421 zone)

EMBL: CP000821.PE548

CP000821.PE548       Location/Qualifiers
FT   CDS_pept        670354..670875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35161"
FT                   /db_xref="GOA:A8FQN8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN8"
FT                   /protein_id="ABV35161.1"
FT                   /translation="MQSQQQADGELVQMFGKVIAIVLLLTLLSILGFRYFASVDKISAQ
FT                   GLRLDHSKLLNVLAMVKGQWLAKGRPSEMRLEWDTSGFQDSEPFIIEGENSEEHTLVKM
FT                   SHGGWPLLDTADSVGCKQLWRQLLGRELVEQQVVTQLNPEGDVCSYIANNSDRLSYQLS
FT                   TGRVVFLTKE"
     atgcagagcc aacagcaagc cgacggtgag ttggtgcaga tgtttggcaa ggtgatagct        60
     atcgttttgc tactcacatt gcttagcata ttagggtttc gttattttgc ctctgtagac       120
     aaaataagtg cccaggggct gcgccttgac cactccaagt tactcaacgt gctggccatg       180
     gtcaaggggc agtggctggc caagggccgt ccatccgaga tgaggctgga gtgggatact       240
     tcaggttttc aggatagtga accgttcatt attgaagggg aaaatagtga agagcacaca       300
     cttgttaaaa tgagtcatgg tggctggccc ctgctcgata cagccgattc agttggctgt       360
     aagcaacttt ggcgtcaatt gttaggcaga gagctggttg agcaacaggt tgtaacgcag       420
     ctcaatcctg agggagatgt ttgtagttat attgctaata actcggatcg attaagttat       480
     caactgtcca cggggcgcgt tgtttttttg acgaaagagt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page