(data stored in ACNUC7421 zone)

EMBL: CP000821.PE549

CP000821.PE549       Location/Qualifiers
FT   CDS_pept        670947..671603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0550"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0395 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35162"
FT                   /db_xref="GOA:A8FQN9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN9"
FT                   /protein_id="ABV35162.1"
FT                   /translation="MRIKNQMLNQVSRKQQGFSLIELVIVIVILGLLAATAIPRFLNVT
FT                   DDAEDASLEGVTGGLATAVGFVRAQWEVDGRSNSSVVLDGTTLSLDTRFGYPTGMVTSG
FT                   SDTGNGNTSATAMTDASCQEVFKYVLQSAPKNVIYTADARKARYTFRVLDGSGGTAIAN
FT                   TGTTVTNLDLCVYHQVASLALNTSSGVPTPTLDLNKGNGIAYNAGTGTVVTFTNN"
     atgaggataa aaaatcaaat gctgaatcaa gtaagtcgaa agcagcaagg tttctcgtta        60
     attgaacttg tgattgtgat tgtgatctta ggcctgttag ccgcgaccgc aattccgcgc       120
     tttctcaatg tcaccgatga tgccgaagat gccagccttg aaggtgttac tggcggcttg       180
     gccacggctg tgggcttcgt aagagcacag tgggaagtcg atggtcgaag taacagtagc       240
     gtagtgctgg acggaacaac gctttctttg gatacacgtt tcggttatcc aacgggaatg       300
     gtaactagtg gttcagatac tggaaatgga aataccagtg cgactgctat gacagatgcg       360
     tcgtgtcagg aagtatttaa atatgttctt cagagcgcgc ctaaaaatgt aatttatacc       420
     gcagatgcaa ggaaggcgag atacacattt cgtgtattag atggttctgg cggaactgcc       480
     atagccaata ccggtacgac tgtgactaac ttagatctat gtgtctatca tcaggtcgca       540
     tcactggcgc tgaacaccag tagcggggta cctactccta cactcgattt aaataaaggt       600
     aacggaatcg catataatgc cggtacaggt accgtagtta cattcacaaa taattaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page