(data stored in ACNUC7421 zone)

EMBL: CP000821.PE55

CP000821.PE55        Location/Qualifiers
FT   CDS_pept        complement(66124..66504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0055"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: shw:Sputw3181_0486 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34668"
FT                   /db_xref="GOA:A8FP95"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP95"
FT                   /protein_id="ABV34668.1"
FT                   /translation="MLNEHDPFNAYKQTSLDARAAAANPHEMVRMLLDGLLDEIERASG
FT                   FMQRRSFEDKGKSINKCLNIVHGLGSMLDLENGGEVASGLNRLYDYCSRQLVTASVENN
FT                   TQALEPITKVISNVREGWANLN"
     atgttgaatg agcatgaccc ctttaatgca tataaacaga ccagcctcga tgccagggct        60
     gcagcggcga atcctcacga gatggtacgc atgttactcg atggtctttt agatgagata       120
     gagcgggcaa gcggctttat gcagaggcgc agttttgagg ataaaggtaa gagtattaat       180
     aagtgcctca acatagtaca cgggctcgga tctatgctcg atttagaaaa tggcggtgaa       240
     gttgccagcg ggctaaaccg cctctatgac tactgcagcc gtcaactcgt taccgccagt       300
     gttgaaaata acactcaagc tttagaaccc attaccaagg taatttcgaa tgtcagagaa       360
     ggctgggcca acctcaattg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page